DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and Ac78C

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_001262138.1 Gene:Ac78C FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster

Alignment Length:1323 Identity:405/1324 (31%)
Similarity:638/1324 (48%) Gaps:305/1324 (23%)


Human    26 LPRSRDWLYESYYCMSQQHPLIV-----FLLLIVMGSCLALLAVF--FALG-LEVEDHVAFLITV 82
            |.||    |.:|....:|..||:     |:|.||    ||.:.:.  ..|| :|.:|..:.    
  Fly   312 LERS----YLTYTHRQRQKSLIIVNVVDFVLKIV----LAFVWIMRRSELGPIESDDGTSM---- 364

Human    83 PTALAIFFAIF-----ILVCIESVFK----KLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQ-- 136
              |.||.:::.     :.:|....::    ..|...::..|:.....|::    |..|...|:  
  Fly   365 --ATAITWSVCCGIANMAICFLGYWRCFANNYLHWAAVCTWVLFNIQGFV----GQGVGFADREY 423

Human   137 -VSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPG----GKEHLVWQILANVI 196
             |.:.||:|||.|.|||..::..::...:|:|.|..|::: :....|    ..|.:::||.||.|
  Fly   424 LVWYILFVIFVPYAMLPLPLKWCVVGGTITASCHLAVITI-IKLQHGEATINPECVLFQIFANFI 487

Human   197 IFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEII 261
            ::...|:||.|.|:|.:...:..:.:|...::.:.:.|.|.::.::||.|:||..:..::::|:.
  Fly   488 LYTAINVAGMYTKYLTDRGQRLAFIETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMY 552

Human   262 QRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIA 326
                  |.........|:.|||....|||||:|||.|||.|||..|..:||.:||:||.:||:||
  Fly   553 ------KGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIA 611

Human   327 KENECMRIKILGDCYYCVSGLPI----SLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVH 387
            ::|.|:|:|:|||||||||....    :.|:||...|:.||.|.:|||.||..|.||:|||:|:|
  Fly   612 EDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGLHMIKAIKDVRLHTHVDLNMRIGIH 676

Human   388 SGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPY 452
            ||:|:|||:|.:||.:||||:||.:|||||:||:|||||||..||:.||.||:||.|:|..||.:
  Fly   677 SGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEATLKCLNDAYEVEPGNGGCRDNH 741

Human   453 LKQHLVKTYFV-----INPKGE--RRSPQHLFRPRHTL--------------------------- 483
            ||...||||.:     :.||..  .||..||.....|.                           
  Fly   742 LKMLNVKTYLIKRTEPLRPKRRFGTRSSAHLAGSVATAAPPCATPTALPKSISASGSGSIGGVTA 806

Human   484 ---DGAKMRASVRMTRYLESWG--AAKPFAHLHHR-------------------DSMTTENG--- 521
               |||.:..  |...|..:..  |.:|...|..:                   ||....||   
  Fly   807 TGNDGASIDG--RSLEYAATIAVPAQQPTQLLQQQQKKNISLNSLPNVVEGVAMDSRRIRNGCGV 869

Human   522 -----------------------------------------------------------KISTTD 527
                                                                       ..||||
  Fly   870 MGGAGGTGGGGTGPCGMSTVSSPTAMMSAPLEVQLRPRNGACSIQNLAEAIDGKGLIIEDESTTD 934

Human   528 ----VPM--------GQHNFQNRTLRTKSQKK----RFEEELNERMIQAIDGINAQKQWLKSEDI 576
                :|.        |.:...:..:.||...:    ..:||::|.:.|.|. ||:.|: ::.|.:
  Fly   935 WIPEIPFKNLNSPEDGLNRADSILVDTKEDHRVSVAVLDEEIDEFIEQNIQ-INSNKE-IRREYL 997

Human   577 QRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTS--VLGISFGAAFLLL 639
            ...:|.|.:|..|:::.......|:..:.|..:|:..:.:.|::::|:.:  ::.:|.|...|..
  Fly   998 NPWTLKFKDKSQEQKFCQLREDMFRSNMLCVFVIWIFMVLCQVIIIPRCTRLIICLSVGTVILTF 1062

Human   640 AFILFVC--FAGQLLQCSKKASPLL-----------------MWLLKSSGIIA------------ 673
            ..:|.:.  |.| |.:|.|..|..|                 |.:|.:.|::.            
  Fly  1063 CCVLVMAEEFPG-LPRCLKTNSAKLVHQRQRRTLFICGVIVSMCMLSAIGLVLCPSSTYIGTADE 1126

Human   674 -NR------PWPRISLT--IITTAIILMMAVFNMFFLS-----------------DSEETI---- 708
             :|      |:..||:|  .....:.|...:.:...:|                 .|:|.:    
  Fly  1127 HSRFLRMVSPYSNISMTEKEFKLNVYLSATIHHNITISTPASGGPTPLVDITSSGPSDEFVRSTL 1191

Human   709 --------PP--------TANTTNTSFSASN---NQVAILRAQN-----LFFLPYFIYSCILGLI 749
                    ||        |..|...|.|.||   :..:::::.:     .....|.:::.:|.|:
  Fly  1192 NALTLNLTPPLPQSHRPYTLTTNGHSVSLSNLSYSDASVMQSSSDVEGQCAHPEYLVFTWVLCLV 1256

Human   750 SCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLGD-YSQVLFERPGIWKDLKTMGSVSLSIF 813
            |.:..|::.|.:|.|:.:..:..|.|:::.....  || :|.|...|.|:     .:| |.:.|.
  Fly  1257 SLATALKLYYLVKALMALAMVAFYTTLIMMKFGS--GDSFSLVELSRLGM-----PLG-VQMLIL 1313

Human   814 FITLLVL----GRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLK 874
            .|:.||:    .|..|...||||:||.:.::|...:::...||..|::|:||.|||.::|:.. .
  Fly  1314 LISFLVMVCYHARLVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYYLSDE-H 1377

Human   875 NEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIK 939
            .:|||.:.::...|||||||:|::||:| |:: .|..|:|:|||||.|||:||.:|:|:.|||||
  Fly  1378 TDELYSKMHNLCGVMFASIPNFQDFYSE-DID-NGKACIRILNEIICDFDELLEEPRFASVEKIK 1440

Human   940 TIGSTYMAATGLSAVPSQEHSQ-EPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINH 1003
            |:|:|||||.||    :.||.: ..|.....:..:||||||:..||:.||..:||:|:|||||..
  Fly  1441 TVGATYMAAAGL----NHEHLRLRGETSEDSVCDLVEFAFAMKQKLEEINGDAFNNFQLRVGICS 1501

Human  1004 GPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGK 1068
            ||:::|||||:||.||||||||||||||||||...::||.|.|:.:|.:.||||..||.|.||||
  Fly  1502 GPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCSRGYTCVKRGEIAVKGK 1566

Human  1069 GDLKTYFVNTEMSRSLSQSNVAS 1091
            |.:.|::|:   .:.:|:|.:.|
  Fly  1567 GMMTTFYVH---PKGISESQLIS 1586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 61/251 (24%)
CYCc 236..439 CDD:214485 104/207 (50%)
Guanylate_cyc 281..465 CDD:278633 108/193 (56%)
DUF1053 495..599 CDD:283888 29/203 (14%)
CYCc 848..1056 CDD:214485 109/209 (52%)
Guanylate_cyc 878..1077 CDD:278633 110/200 (55%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 8/17 (47%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 1/3 (33%)
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 64/258 (25%)
CYCc 526..729 CDD:214485 105/209 (50%)
Guanylate_cyc 566..753 CDD:278633 108/187 (58%)
DUF1053 929..1020 CDD:283888 21/93 (23%)
CYCc 1353..1554 CDD:214485 109/208 (52%)
Guanylate_cyc 1381..1576 CDD:278633 110/204 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.