DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and Ac76E

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_001246838.1 Gene:Ac76E FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster

Alignment Length:1345 Identity:443/1346 (33%)
Similarity:656/1346 (49%) Gaps:354/1346 (26%)


Human    12 LRDRSEEAAGG-------GDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFALG 69
            |.|.||:..|.       .|...|.|..|.:|.:    :..|:..||..|         |...:|
  Fly    50 LADLSEQENGTTAEDIHLNDLYTRYRQRLRKSLF----RSGLLTSLLACV---------VSIIIG 101

Human    70 LEVEDHVAFLITVPTALAIFFAIF---ILVCIESVFKKLLRLFSLVIWICLV---AMGYLFMCFG 128
            :....|:     |.|.|.:..|:.   ||..::  |..:|...:..:...:|   ::|.:....|
  Fly   102 IVYGQHL-----VQTMLLVLAALISGSILTALQ--FPAVLSSPAAALAFAIVTTFSLGTIAAITG 159

Human   129 GTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILA 193
            ..::|....:.||    .:::|||.:...:::.::..::.|.:..   :..:|....:|. .:..
  Fly   160 DELAPLPMYALFL----CIHSMLPISWPVSVVLALFMTAIHIVYR---IGTSPDYAPNLP-MLFG 216

Human   194 NVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKA 258
            .:::....:::|.|::.:.:.|..:|...|...|:.|:|||.|:.|||:||||::||:||.|:|.
  Fly   217 EIVMLASASVSGLYYRIMSDAAHNRTVDGTRTGIEQRVKLECEREQQEQLLLSVIPAYIAAEVKR 281

Human   259 EIIQRLQG--PKAGQMENTN--NFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELF 319
            .|:.::..  .:||...:|:  .||.|:|:|||||:||:||||.||.|:|..:..:||..||:||
  Fly   282 SIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLF 346

Human   320 GKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRV 384
            |:|||||:||:|:||||||||||||||||||.|.||.|||.|||.|.:||:.||:|||::::||:
  Fly   347 GRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIRHVREATGINVDMRI 411

Human   385 GVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIR 449
            |:|:|||||||:||:|||:||||.|||||||||:|||.|||||:..||:.|...::||:|:|..|
  Fly   412 GIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFLGDKFEVEQGEGGNR 476

Human   450 DPYLKQHLVKTYFVINPK----------------------------------------------- 467
            |.||..|.|::|.::.||                                               
  Fly   477 DAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKEIKETDQSHEATDVADVLLP 541

Human   468 ----------GERRSPQHL---------------------------------------------- 476
                      .|:.||..:                                              
  Fly   542 VTVAPPPAIVDEKMSPTSINSQEAPLHAPLASAASMSIKELSEEEDEADEATAVTEPLMHRDQDG 606

Human   477 ----------------------------------------------------------------- 476
                                                                             
  Fly   607 KNDKEPKANGGHRGSGDSAASESVAKSAALSLPADDLLSMSGSESGISNSGAQAQSSNPASVTPT 671

Human   477 ---------------------------------FRPRHTLDGA---------------------- 486
                                             |..|....||                      
  Fly   672 AAAPAGGAASNSLTVAEAPERSRRKLSVQGLMSFADRRRSSGAFIEGRKLSIHSGESFRSHAGHV 736

Human   487 -KMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFE 550
             :.|.|.:||:|:|.|||.:|||::  .:|...:|  |....:.|.:.|.      ...::|.|.
  Fly   737 TRNRPSSKMTKYVECWGADRPFANI--AESKLVKN--IGLASIAMIESNL------LPPERKCFN 791

Human   551 EELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIF 615
            ...                :....:::..::.:.|...|..|||.....|::.:.||.::|..:.
  Fly   792 FNF----------------FGPPTELKPFTMWYRNTPREAMYRAQPDTHFRFDLICAFVLFLSLA 840

Human   616 IVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP-LLMWLLKSSG---IIANRP 676
            :||::|:.....|..|..|:|:.||..|::         |..:.| :.....:.:|   ::|:..
  Fly   841 VVQLIVIELNLALLGSLLASFVSLALFLYL---------SNMSVPDVHASTTERNGPGQVVASSR 896

Human   677 WPRISLTIITTAIILMMAVFNMFFLSDSEETIP------PTANTT--NTSFSA--SNNQVAILRA 731
            :.|:::.::...:|...|||::.     ..|:|      |::|.|  .::||:  .|:.:..::.
  Fly   897 YLRLAMFVVVNILISSCAVFSVI-----NYTVPDGVSKEPSSNQTILESNFSSVFVNSTLEDVQL 956

Human   732 QNLFF----LPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLGDYSQVL 792
            ..:.:    .|.|:|.|.:.|.:.|.|||..:.||::.|:||::...|:|         .||. |
  Fly   957 WEIDYAIPIAPVFLYCCAISLAAISAFLRSGFILKLIAMLVAVIAQVTVL---------GYSD-L 1011

Human   793 FERPGIWKD--------LKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETME 849
            ||   ::.|        |:..|.:.|.:..:.|..|.||.||..|.|||||.|.|.|:||:|||.
  Fly  1012 FE---MYNDANITHGLPLEIKGFLLLLVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMR 1073

Human   850 NLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLR 914
            .:|::||||:||||||.|||... ::.||||:||.||.|||||||::||||.|:||||:||||||
  Fly  1074 GINKILLENILPAHVATHFLHLE-RSTELYHESYSCVAVMFASIPNYKEFYDETDVNKQGLECLR 1137

Human   915 LLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGL-----SAVPSQEHSQEPERQYMHIGTMV 974
            ||||||.|||.||.||||||:||||||.||||.|:||     ....|:..:.|...:..::..:|
  Fly  1138 LLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEKRTEEHNVVILV 1202

Human   975 EFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDK 1039
            |||.||:..||:||:.||..|:||:|:||||||||||||||||||||.|||||||||||.||:.:
  Fly  1203 EFAIALMSILDSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSCGVMGR 1267

Human  1040 IQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSL 1084
            :|.||.|:.:|.|.||.|.|||:..|||||:|.||||.|.....|
  Fly  1268 LQTTENTAKILMTAGYECECRGLTYVKGKGNLVTYFVKTPFDGKL 1312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 53/233 (23%)
CYCc 236..439 CDD:214485 127/207 (61%)
Guanylate_cyc 281..465 CDD:278633 118/184 (64%)
DUF1053 495..599 CDD:283888 21/104 (20%)
CYCc 848..1056 CDD:214485 134/213 (63%)
Guanylate_cyc 878..1077 CDD:278633 132/204 (65%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 15/17 (88%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 2/3 (67%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 57/250 (23%)
CYCc 259..467 CDD:214485 127/208 (61%)
Guanylate_cyc 311..469 CDD:278633 106/158 (67%)
BASP1 510..667 CDD:283191 3/157 (2%)
CYCc 1079..1283 CDD:214485 131/205 (64%)
Guanylate_cyc 1101..1305 CDD:278633 132/204 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112034323
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H75133
Inparanoid 1 1.050 733 1.000 Inparanoid score I595
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D181177at33208
OrthoFinder 1 1.000 FOG0001246
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4464
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.