DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and CG32301

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_728724.2 Gene:CG32301 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster

Alignment Length:1183 Identity:322/1184 (27%)
Similarity:520/1184 (44%) Gaps:245/1184 (21%)


Human    31 DWLYESYYCMSQQ---------HPLIVFLL--LIVMGSCLALLAVFFALGLEVEDHVAFLITVPT 84
            :|....|.|...:         |.:.|.|:  ||::...|.|:.|.  |...|..::.||..:| 
  Fly    22 EWKLLRYKCRELRLEGVYHRHCHLVSVALVTQLIIVIEILMLIHVI--LLFSVVKNIDFLTVLP- 83

Human    85 ALAIFFAIFIL--------------------VCIESVFKKLLRLFSLVIWICLVAMGYLFMCFGG 129
                :||:.:|                    :.:..:...||....|::.||      .|..| .
  Fly    84 ----YFAVMLLTPSILMPSREPNVEQYESIAILVSCLMALLLTAMDLILPIC------YFRPF-S 137

Human   130 TVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCL----------SATPGGK 184
            .|..:|.|     :|.::|.|.|       ||.|....::.:.|:|.|          ..:...|
  Fly   138 LVPSYDHV-----VIVLIYLMFP-------IAFVKNGRAYFLGLAVSLFYFGYMALIDKISTLDK 190

Human   185 EHLVWQILA-NVIIFICGNLA---GAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLL 245
               ||::.| ...:|....|.   ..:.::.|...:...||    .:...:..:...::::.||.
  Fly   191 ---VWELTAYGAYLFFLNMLCMFLSRFQEYNMRSGILSRYQ----VVYQNLVFQMAMKEEKALLD 248

Human   246 SLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGE 310
            |::|..:|..::..|...::...:..|..|...| |:::.|..||||.||:|.||.|.:.....:
  Fly   249 SIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRH-LFMEPHPEVSILEADMVDFTGLTTTMEVSD 312

Human   311 LVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDA 375
            ||.:|:|||..||..|..|...|||.|||.|.||:|:|...|.||..||...|||.|..::|...
  Fly   313 LVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVSKR 377

Human   376 TGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYK 440
            ....|::|:|||||.:|.|:|||.|||:|:||.||.:.|.:|:.|:||.|||||.||..|:..|.
  Fly   378 RNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYV 442

Human   441 VEEGDGDIR-DPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAKMRASVRMTRYLESWGAA 504
            .|||....: ||.|::..:.||.:       ||....|.....|:.    .:..:..|..|:..:
  Fly   443 YEEGTDTAKLDPLLQRSNLSTYLI-------RSRLPNFEDTDDLED----DNFSLNDYRFSFSFS 496

Human   505 KPFAHLH---HRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQK---KRFEEELNERMIQAIDG 563
            :.:..:.   .||.:      :....:|:      ||....|.::   :..:|::||.       
  Fly   497 QDYEDIQVKAQRDMI------LEVEHMPV------NRVQTCKIRRPMHRIAKEDINEE------- 542

Human   564 INAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF--------------KYYVTCACLIFFCI 614
                                |...||..|..|...::              ||  :...::|...
  Fly   543 --------------------YRFHLESYYLFTTFRSWRMEWSFNKMRDLLMKY--SLGMMVFAGA 585

Human   615 FIVQILVLPKTSVLGIS-FGAAFLLLAFILFVCFAGQLLQCSKKASP-------LLMWLLKSSGI 671
            .|:.:.:|.|:..:..: ..:.|||:...|.:....:|....::.||       |..|.:|:|.:
  Fly   586 TIIAMDLLVKSEAMDYTMLFSLFLLILLPLLLASYKKLWLRGRRLSPITQPTFFLSRWFIKASDL 650

Human   672 IANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFF 736
            |....:.||.|.|:...::.:|          |.||: .:.:.........|:::..||.|.|.|
  Fly   651 IEKSVFVRIPLAIMVLFLLYVM----------SSETV-FSCDIARLELEIINSELHNLRPQMLCF 704

Human   737 LPYFI-YSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLGDYSQVLFERP---- 796
            :|:.: |:.::.|....|.:.:...:|:.:.: |::|.:.|.:|.       |....|||.    
  Fly   705 MPWGVTYAVVIVLSLMLVIIGIPLIIKLGVGL-AILGSHVITVHA-------YYGFAFERSQTTN 761

Human   797 -GIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVL 860
             |:...|  ..|..:..|||.::|......|..:..:.....|:|:.|..:......::::.|:|
  Fly   762 IGVTSSL--AHSWYMVAFFIVVVVREGYLNYILKASYFMSMCFEKKHELTKVKTRTIKIIMANIL 824

Human   861 PAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDD 925
            |.||||.|..|. ::::||::::..|.||||:|.::       :.:|.|   ||.|:|:|..||:
  Fly   825 PTHVAEVFKVRR-RSDQLYYENFSQVAVMFATIENY-------EADKSG---LRALHEMICYFDE 878

Human   926 LL-SKPKFSGVEKIKTIGSTYMAATGLS---------AVPSQEHSQEPERQY------------- 967
            || :...:..:||||.:|.||:||.||.         :||...:.:..:.|.             
  Fly   879 LLVNYQSWYKIEKIKVMGWTYLAACGLHVDHYTDFSVSVPISTNRESDKLQKSGSVRFAPMDGDE 943

Human   968 -----MH------------IGTMVEFAFALVGKL-DAINKHSF--NDFK----LRVGINHGPVIA 1008
                 :|            |..|.|||..|:..| |..:|..|  .|.|    |::||.||||:|
  Fly   944 IMIKDLHPTQATTNEDDNTILVMTEFALNLLRILRDIRSKGIFFEKDSKLTGSLKIGIAHGPVMA 1008

Human  1009 GVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKT 1073
            ||:|..||.|||||:|||:||||.||||.|.|.|||.|:.||:.....||.||:..|||.|.:.|
  Fly  1009 GVVGLSKPHYDIWGHTVNMASRMTSTGVRDGIHVTESTANVLRDFNIRCTYRGMTFVKGVGQVPT 1073

Human  1074 YFVNTEMSRSLSQ 1086
            |.|:.:.:....|
  Fly  1074 YLVDLDENLHFQQ 1086

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 52/272 (19%)
CYCc 236..439 CDD:214485 85/203 (42%)
Guanylate_cyc 281..465 CDD:278633 85/185 (46%)
DUF1053 495..599 CDD:283888 16/110 (15%)
CYCc 848..1056 CDD:214485 92/255 (36%)
Guanylate_cyc 878..1077 CDD:278633 94/246 (38%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 7/17 (41%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 1/5 (20%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 76/156 (49%)
CYCc 812..1051 CDD:214485 92/250 (37%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 93/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113540481
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.