DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and ACXD

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_620469.2 Gene:ACXD FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster

Alignment Length:1189 Identity:328/1190 (28%)
Similarity:526/1190 (44%) Gaps:281/1190 (24%)


Human    62 LAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICL--------- 117
            |.:|..:.:.| .|...|:|.|....::..:...:|           ..||||:.|         
  Fly    67 LFIFIHVAVTV-IHTLLLLTTPEIKYVYVDMVAYMC-----------SGLVIWVVLGVNFRSELV 119

Human   118 -------VAMGYLFMC----------------FGGTVSP-WDQVSFFLFIIF--VVYTMLPFNMR 156
                   .|..:|.:|                ....::| :|..:.:...:|  |.|.:.||   
  Fly   120 SKHGWVVYATSWLAVCVMVLMDIGLNVYHATSHNDILNPIYDAYTLYAIYMFMPVPYLLQPF--- 181

Human   157 DAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQ 221
              ::.|.:| ..:.|..|..::|....:.|   .||...|...|.||.|.:.:.:.::||:.|:.
  Fly   182 --VLGSAVT-FCYIINYSFVITAKDDNQMH---SILNEAIYLSCVNLLGIFFRLMRDIALRTTFL 240

Human   222 DTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTN---------- 276
            |....::..:.|.:.:.|:..||||:|||.||..::.::..|::..|....:.:.          
  Fly   241 DRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQ 305

Human   277 --------NFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMR 333
                    :...|:::.|.:|::||||:|.:|.|.:.....:||..|::||.:||..::|...:|
  Fly   306 TLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLR 370

Human   334 IKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGL 398
            ||.||||||||:||.....:|||.||.:||.|.:.|:.||:...::|:||:|||||:||.||||.
  Fly   371 IKFLGDCYYCVAGLANPNADHAKCCVDLGLRMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGA 435

Human   399 QKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIR-DPYLKQHLVKTYF 462
            .|||:|:||.||.:||.:||.|..||||:|..||..|:|.|..|:|....| ||.|::|.::|:.
  Fly   436 AKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFL 500

Human   463 VINPKGERRSPQHLFRPR-------------------HTLDGAKMRASVRMTRYLESWGAAKPFA 508
            :.:.:.....|:...|.|                   |..:..:.:|.:.|.|.|          
  Fly   501 IKS
LRAPMHDPRRRMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLEMCREL---------- 555

Human   509 HLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGI----NAQKQ 569
                 |.|..  |:|..|.|      |:..|..|:.:   .|||...|.|.:....    |.:.|
  Fly   556 -----DKMPI--GRIQLTKV------FRRSTRLTQDE---IEEETFRRNISSCCLFFRIRNWEFQ 604

Human   570 WLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGISFGA 634
            ::|..|:.                      .||.:..|.:|:..:..:|:|............|.
  Fly   605 YIKEPDVM----------------------LKYSIALAWVIYMGLLTIQLLSKDARYHYWYIDGT 647

Human   635 AFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTA------IILMM 693
            ..:||..:|.|.:..:|            |::..|....:.|..|:|..:...:      :::.:
  Fly   648 TIILLTMLLIVSWYKKL------------WIMYMSDADVSSPNGRLSGFLFRMSDEMQRNVVIRV 700

Human   694 AVFNMFFLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCS-VFLRV 757
            .::.:...|.....|......::....|..:.....|.|  .|.|:.:.:|:..:|..| :|.|:
  Fly   701 VMYFLIIFSYCAVAIMQVVGCSSDEDYADLDPTYDERVQ--CFHPWILTNCMTLVIGMSFLFTRI 763

Human   758 NYELKMLIMMVALVGYNTILL-----------HTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLS 811
            .:.:|.....:.::||..:::           .|:.:....||.:|            :..::..
  Fly   764 PFIIKSCFSALIMIGYAVLVVSEFNFIYANSPSTNVNFNAKYSHIL------------LMIITFG 816

Human   812 IFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNE 876
            ||.:    :.||.|:..::|:.||.:..|::|:.....:..:|||.|:||.|||:.:|:..|:| 
  Fly   817 IFHL----MERQTEFIAKVDYNWKRQLIKKQEDALITNDTIKVLLTNILPTHVADFYLSNQLQN- 876

Human   877 ELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFS-GVEKIKT 940
            |||::.||.|.||||||.:|       |.:|.|   ||:|||||.||||:|:|...| .|||||.
  Fly   877 ELYYEEYDNVAVMFASIKNF-------DTDKIG---LRVLNEIICDFDDVLNKYSQSLRVEKIKV 931

Human   941 IGSTYMAATGL------------------SAVPSQEHSQ-------------------------- 961
            ...|||||.||                  |.:|:...|:                          
  Fly   932 ANWTYMAACGLDVSRSEQVNAPQMKFRNVSLMPNGRRSRYDGARSSNADGVQRVPYGNGSNIALD 996

Human   962 -EPER-QY-------------MHIGT--------MVEFAFALVGKLDAINKHSF-------NDF- 995
             :.|| ||             .|.|:        |.|||..|:..:...|..:.       .|: 
  Fly   997 LDLERGQYEGNVITSGPRISSTHNGSSSNEVVRVMAEFALDLMRTMRRFNTENMQTEYEGSTDYG 1061

Human   996 KLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCR 1060
            .||:||:||..:|||:|..||.||||||.||:|||||||||..:|||||.|:|.|:.....|..|
  Fly  1062 MLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDSTGVPGQIQVTENTALKLREFNIQCNYR 1126

Human  1061 GIINVKGKGDLKTYFVNTE 1079
            |:..|||:|::.||.:..:
  Fly  1127 GMTFVKGRGNIPTYIIGID 1145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 51/233 (22%)
CYCc 236..439 CDD:214485 90/221 (41%)
Guanylate_cyc 281..465 CDD:278633 87/185 (47%)
DUF1053 495..599 CDD:283888 20/108 (19%)
CYCc 848..1056 CDD:214485 107/284 (38%)
Guanylate_cyc 878..1077 CDD:278633 103/275 (37%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 9/17 (53%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 0/10 (0%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831 52/238 (22%)
CYCc 254..476 CDD:214485 90/222 (41%)
Nucleotidyl_cyc_III 321..503 CDD:299850 86/182 (47%)
CYCc 856..1117 CDD:214485 106/272 (39%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 103/274 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110509287
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.