DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and ACXC

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_609593.1 Gene:ACXC FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster

Alignment Length:1182 Identity:324/1183 (27%)
Similarity:533/1183 (45%) Gaps:202/1183 (17%)


Human     1 MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPL--IVFLLLIVMGSCLALL- 62
            :|:.:     |||::.:|       |....::.|.....|.....:  ::|::|.:....:.|| 
  Fly    30 LWEHS-----YLREKCKE-------LNLEEEYRYYQVRLMVSNLTIFYVLFIILAMSFLTIELLY 82

Human    63 -----AVFFALGLEVEDHVAFLITVPTALAIFFA---------IFILVCIESVFKKLLRLFSLVI 113
                 ||||...:    .|...|.|.|.|:|.|.         :.|...:.||:        ||:
  Fly    83 VQHYNAVFFNFVI----RVVSTILVLTVLSINFCEKFVSRHRWVMIASSVLSVY--------LVV 135

Human   114 WICLVAMGYLFMCFGGTVSPWD-QVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVL---- 173
            ...:|.:.|.|.     .:.|. ..||.:|.:.::|..||.   .:|..:.|.:||.:::.    
  Fly   136 LTDIVMISYHFY-----KNDWPLNTSFDVFTLCMIYMFLPI---PSIKGAALLASSVSLIYVAFF 192

Human   174 --SVCLSATPGGKEHLVWQILANVIIFICG-NLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEF 235
              |:..:|....::...:.:::..|:...| |:.|.:.:.:.:..::.::.|....|.....|..
  Fly   193 MHSLTFNAVYTDRDSFGYDVISTDILHNLGFNMMGIFFRIMNDTMVRASFLDRHQFIMEETWLRH 257

Human   236 EKRQQERLLLSLLPAHIAM----EMKAEIIQRLQGPKAGQM--ENTNNFHNLYVKRHTNVSILYA 294
            ...|:..||.|:||..||.    ::|::|.|....|...||  ..|.:|  :.::.|.:||||||
  Fly   258 ALLQESILLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESF--MAIQIHPDVSILYA 320

Human   295 DIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCV 359
            |:|.:|.|.:..:.|.||.:|::|:|:||..|...:..|||.||||||||:||....|:|||.||
  Fly   321 DVVNYTHLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCV 385

Human   360 KMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGR 424
            .:|:.|...|::||...|:||:||:|||||::|.|:||..|.|:|:|..||.:|||:|:.|.||.
  Fly   386 SLGISMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGY 450

Human   425 VHISSVTLEHLNGA-YKVEEGDGDIR-DPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK 487
            ||:|..||..||.| |.:..|....: ||.|:  .:.||.:   .|:......:     |..|..
  Fly   451 VHVSGRTLSMLNPADYTILSGTQKAQSDPVLQ--YIHTYLL---TGQVARESFI-----TSIGGV 505

Human   488 MRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQN---RTLRTKSQKKRF 549
            ..:||...:.::...:::|     .:.|||.| .:....::|:|..|..:   |..|..:.||  
  Fly   506 RSSSVLEVKSIDRIRSSRP-----SQSSMTDE-FREEFRNMPVGGINLNSPCCRRTRLDTHKK-- 562

Human   550 EEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCI 614
                                  ...:|......|.:..||..|.......||..:..|..|..|:
  Fly   563 ----------------------TQREIGIFCAAFKDSSLEWNYLHQPDFIFKSSMLLAWGIGCCL 605

Human   615 FIVQILV--LPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPW 677
            ..:||:.  ...|:.:.:.....|.|.:.:   |.|.....|..|:......:......:|...:
  Fly   606 IYIQIVTNNFSCTACIVVDLVTFFFLTSLL---CLAWYKNVCWWKSGRYEFRIYGKYSCMAFHIF 667

Human   678 PRIS------LTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFSASNNQVAILRAQ---N 733
            .:|.      :|:....:....||.::..|           |.....:..|..:..|...:   :
  Fly   668 EKIQHSVSLRITVYLGILFSYYAVISLIML-----------NCDRDMYELSYIESKIYHYEMDRD 721

Human   734 LFFLPYF---IYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVLGDYSQVLFER 795
            ..|.|:.   :.|.|||:  ...|.|:.:.||::|.....:.|..|:....|.:   :.......
  Fly   722 TCFHPWVFTNMISLILGI--SYTFARIPFGLKIVISCCETLAYLLIVFFQFAFI---FQHSATTT 781

Human   796 PGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVL 860
            |.:..:|  ...:.:.:..:|:....||:|:..::::......:.:::..:.......:||.|:|
  Fly   782 PFMKAEL--AHCLRVCMMLLTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQSIIILLNNIL 844

Human   861 PAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDD 925
            |:||.:.:| .||...|||:::|..|.||||.:.:|          ...|..||:||:||..||.
  Fly   845 PSHVVDLYL-NSLAKHELYYENYRMVSVMFAMLINF----------PMNLPSLRVLNDIITQFDR 898

Human   926 LLSK-PKFSGVEKIKTIGSTYMAATGL-----SAVPSQEHSQ------EPERQYMH--------- 969
            ||:. .::..|||||.:|.|||||.||     |.:...:|.:      |.|....|         
  Fly   899 LLTAYREYYVVEKIKVVGCTYMAACGLDFNLASNIRQTDHFRNSSLHVEVEHARNHRMTDENYDS 963

Human   970 -------IGTMVEFAFALVGKLDAINK--------HSFNDFKLRVGINHGPVIAGVIGAQKPQYD 1019
                   :..|..||..|:..|.|.|:        .|.:..|:.:||:.|.::|||:||.:|.||
  Fly   964 DMNNDEVVFIMTTFALDLMRTLAACNRAYSSSFFERSLSQGKICIGISSGEIMAGVVGASQPHYD 1028

Human  1020 IWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTE----- 1079
            ||||.||:||||:|||:...||||||::.:||.....|..||:..|||:||:.||||..:     
  Fly  1029 IWGNPVNMASRMESTGLPGHIQVTEESAKILQEFDIKCIYRGMTFVKGRGDIPTYFVGIDENLKF 1093

Human  1080 -----MSRSLSQ 1086
                 ::||||:
  Fly  1094 MSAKLVNRSLSR 1105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 54/256 (21%)
CYCc 236..439 CDD:214485 95/210 (45%)
Guanylate_cyc 281..465 CDD:278633 86/186 (46%)
DUF1053 495..599 CDD:283888 17/107 (16%)
CYCc 848..1056 CDD:214485 90/244 (37%)
Guanylate_cyc 878..1077 CDD:278633 91/235 (39%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 7/17 (41%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 1/3 (33%)
ACXCNP_609593.1 AC_N <33..285 CDD:292831 59/284 (21%)
CYCc 293..468 CDD:214485 85/177 (48%)
Nucleotidyl_cyc_III 307..466 CDD:299850 79/159 (50%)
CYCc 833..1060 CDD:214485 89/238 (37%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110509209
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.