DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and CG32305

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_728725.2 Gene:CG32305 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster

Alignment Length:1163 Identity:315/1164 (27%)
Similarity:519/1164 (45%) Gaps:226/1164 (19%)


Human    40 MSQQHPLIVFLLLIVMGSCLALLAVFFALGLEVEDHVAFLIT-VPTALAIFFAIFILVCIESVFK 103
            ||....:|..:.|:::...:.|||:       |:|.:  |:| ||     :||:.:.    |.|.
  Fly    51 MSNVVQIIWHVELLMVAHVILLLAL-------VKDII--LVTMVP-----YFAVMLF----SPFI 97

Human   104 KLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFFLFIIF--VVYTMLPFNMRDAIIASVLT- 165
            .||.:.:.|..|....:.:|...|   ::..|.||..|..|:  ..|..:|......:::..:| 
  Fly    98 MLLSMQNNVGMITNTLISWLMALF---LTSMDLVSDLLGTIYSGAAYPTVPCYDHVVLVSVYMTL 159

Human   166 -----SSSHTIVLSVCLSATPGG--------KEHLVWQILANVIIFICG-NLAGAYHKHLMELAL 216
                 ..|...||.:.:|....|        .:.:.:.:||:..|::.. ||..::...:.:..|
  Fly   160 PIAFYQGSSVYVLGMVVSIIYIGYAFYMQYLNDQVSFYLLASYAIYLFTLNLIFSFFTIIRDYGL 224

Human   217 QQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNL 281
            ::........:...|..:...:::..||.|:||..:...::.||..|::........:......|
  Fly   225 RRAILSRYQLVYQNIVYQLVMKKENGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSKAGLRKL 289

Human   282 YVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSG 346
            :::.:.|||||.||:|.:|.|.:.....:||.:|::||..||..|..|..||||.|||.|.||:|
  Fly   290 FLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAG 354

Human   347 LPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVT 411
            :|...|.||..||...|:|....:.|.....:|||:|:|||||.|..|:||..|||:|:||.||.
  Fly   355 IPNYFPAHASCCVDQALEMIHITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVD 419

Human   412 LANHMEAGGVPGRVHISSVTLEHLNGAYKVEEG-DGDIRDPYLKQHLVKTYFVINPKGERRSPQH 475
            :.|.:|:.|:||.||:|..||..|:..|...|| :....||.|:|..::|:.|.|...:...|..
  Fly   420 ITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPILQQAGIRTFLVSNRLPDAVEPGE 484

Human   476 LFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL 540
                   ||.....||:...|.  |:|.......:..:..:..|     ...:.:|....:.|  
  Fly   485 -------LDDELSSASINSCRL--SYGGYYEEIQIKAQREIMKE-----VDQMAVGHCFIEWR-- 533

Human   541 RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALP--AFKY- 602
            |:.|.||   ::.||             ::|.|..|..:..:|  :..::|:....||  ..|| 
  Fly   534 RSSSMKK---QDFNE-------------EYLFSNQIHLVLGVF--RSWKREWEFHNLPDLMIKYT 580

Human   603 --YVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP----- 660
              .|.||.|....|.:::....|...||   .|...:||...:...:....||. ||.:|     
  Fly   581 MLLVLCAGLAIMSINLIEEATYPDILVL---LGILLILLILCILAGYKKLRLQW-KKLTPMSQPS 641

Human   661 --LLMWLLKSSGIIANRPWPRISLTIITTAIILMM---AVFNMFFLSDSEETIPPTANTTNTSFS 720
              |..|||:.|..|.:..:.||.||::...::.:|   |||                     |..
  Fly   642 CFLSRWLLRISERIEDSLFVRIPLTMVVLLLLYVMSSQAVF---------------------SCD 685

Human   721 ASNNQVAILRAQNLF--------FLPYFIYSCILGLIS-------CSVFLRVNYELKMLIMMVAL 770
            .:..:::|:.| :|:        |.|:.:..|::.:||       |.:.:::            |
  Fly   686 VAKLELSIIEA-HLYNEKSYAECFGPWTVTYCVVIVISLLFVVPGCPLVIKI------------L 737

Human   771 VGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVS-------LSIFFITLLVLGRQNEYYC 828
            .|  .::|..|...:..|....|||    .:...:|..|       |...||.|::..|...|..
  Fly   738 AG--LLILGLHLGTVHLYYGFAFER----SETTDLGLKSDYAHTWYLVALFIVLVLRERHVNYLR 796

Human   829 RLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASI 893
            :.::..:..:::..::.:......::::.|:||.|||:.:..|. .:::||::::..|.||||||
  Fly   797 KFNYFMRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRR-PHDQLYYENFSKVAVMFASI 860

Human   894 PDFKEFYTESDVNKEGLECLRLLNEIIADFDDLL--SKPKFSGVEKIKTIGSTYMAATGLSA--- 953
            .:|       :.:..|   ||:|:|||..|||||  .:.::. :||||.:|.|||.|.||..   
  Fly   861 ENF-------NADTAG---LRILHEIICCFDDLLVDYQTRYK-IEKIKVMGWTYMVACGLETDHY 914

Human   954 ------VPSQEHSQEPERQ------YMHIGT-------------------------MVEFAFALV 981
                  :|.::...:.|.:      .:|.|:                         |.|||..|:
  Fly   915 TDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFALDLL 979

Human   982 GKLDAIN-KHSFNDF------KLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDK 1039
            ..:..|. .:.|:::      .|::||:||.|:|||:|..||.|||||:|||:||||.|||:||.
  Fly   980 RIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLLDN 1044

Human  1040 IQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFV----------NTEMSRSLSQS 1087
            ||||..|:.||:.....|..||...|||.|.:.||.|          :.::|.|:..|
  Fly  1045 IQVTRHTAKVLRQFNIRCNYRGHTEVKGVGKVPTYLVVVDPDLTFQDHDQVSMSMKDS 1102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 49/238 (21%)
CYCc 236..439 CDD:214485 80/203 (39%)
Guanylate_cyc 281..465 CDD:278633 81/185 (44%)
DUF1053 495..599 CDD:283888 19/106 (18%)
CYCc 848..1056 CDD:214485 87/257 (34%)
Guanylate_cyc 878..1077 CDD:278633 90/258 (35%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 7/17 (41%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 1/3 (33%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 81/198 (41%)
Nucleotidyl_cyc_III 292..445 CDD:299850 71/153 (46%)
CYCc 814..1056 CDD:214485 87/254 (34%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 89/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113540460
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5262
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.