DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIX2 and Six4

Sequence 1:XP_005264157.1 Gene:SIX2 HGNCID:10888 Length:293 Species:Homo sapiens
Sequence 2:NP_649256.1 Gene:Six4 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster

Alignment Length:177 Identity:110/178 (62%)
Similarity:137/178 (77%) Gaps:0/178 (0%)


Human     9 FTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESH 73
            |:.:|:.|:||.|||.|:||:|..||.|||..|....|||||:|:|:||::.|.|.|||.:||:|
  Fly   181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETH 245

Human    74 QFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSV 138
            .||...|..||.||.||||.||||:||||||||.|||:|:|:|||::|||||||.||||||||:.
  Fly   246 CFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNA 310

Human   139 LREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185
            |::.|..|.||:|.||:.||:.||||.|||||||||||||||..:.:
  Fly   311 LKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIX2XP_005264157.1 SIX1_SD 9..118 CDD:318970 65/109 (60%)
homeodomain 129..180 CDD:238039 36/51 (71%)
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 65/109 (60%)
homeodomain 301..355 CDD:238039 37/54 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.