DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and Kat60

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:233 Identity:86/233 - (36%)
Similarity:130/233 - (55%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   329 DPVQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKLP-KGILLVGPPGTGKTLLARA 391
            ||    .|.:..:..:.:||:.|:|.|.. :..|..|.  |.:.| ||:|:|||||||||:||:|
  Fly   320 DP----KVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRRPWKGVLMVGPPGTGKTMLAKA 378

Human   392 VAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYS 456
            ||.|....|:..|.:.....:.|.....:|.||..|:..||..|||||:||:..:|.....|..|
  Fly   379 VATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDSLCSRRGSESEHEAS 443

Human   457 RQTINQLLAEMDGFKPNEG----VIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILK 517
            |:..::||.:|||....|.    |:::.|||||..:|.||.|  |.:.::.:|.|..:||..:||
  Fly   444 RRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR--RLEKRIYIPLPSDEGREALLK 506

Human   518 WYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAAL 555
            ..|.::|.|.|||...:|....|:|||::.|:..:|::
  Fly   507 INLREVKVDDSVDLTYVANELKGYSGADITNVCREASM 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 27/65 (42%)
FtsH_fam 333..766 CDD:273520 84/229 (37%)
AAA 375..506 CDD:278434 53/134 (40%)
Peptidase_M41 586..764 CDD:279742
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 25/57 (44%)
AAA 358..496 CDD:214640 57/139 (41%)
AAA 362..495 CDD:278434 53/134 (40%)
Vps4_C <570..603 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.