| Sequence 1: | NP_647473.1 | Gene: | YME1L1 / 10730 | HGNCID: | 12843 | Length: | 773 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262276.1 | Gene: | Kat60 / 53566 | FlyBaseID: | FBgn0040208 | Length: | 605 | Species: | Drosophila melanogaster | 
| Alignment Length: | 233 | Identity: | 86/233 - (36%) | 
|---|---|---|---|
| Similarity: | 130/233 - (55%) | Gaps: | 14/233 - (6%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human   329 DPVQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKLP-KGILLVGPPGTGKTLLARA 391 
Human   392 VAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYS 456 
Human   457 RQTINQLLAEMDGFKPNEG----VIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILK 517 
Human   518 WYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAAL 555 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| YME1L1 | NP_647473.1 | P-loop_NTPase | 331..>395 | CDD:304359 | 27/65 (42%) | 
| FtsH_fam | 333..766 | CDD:273520 | 84/229 (37%) | ||
| AAA | 375..506 | CDD:278434 | 53/134 (40%) | ||
| Peptidase_M41 | 586..764 | CDD:279742 | |||
| Kat60 | NP_001262276.1 | HCV_NS5a_C | <163..243 | CDD:289693 | |
| P-loop_NTPase | 325..>381 | CDD:304359 | 25/57 (44%) | ||
| AAA | 358..496 | CDD:214640 | 57/139 (41%) | ||
| AAA | 362..495 | CDD:278434 | 53/134 (40%) | ||
| Vps4_C | <570..603 | CDD:286426 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||