DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and Rpt2

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:406 Identity:117/406 - (28%)
Similarity:199/406 - (49%) Gaps:45/406 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   185 HSRA------LQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFLLRD 243
            |:|.      |:.|...|.....||:::         .||:...|:..|.::....      ||.
  Fly    54 HTRCRLKLLKLERIKDYLMMEDEFIRNQ---------ERLKPQDEKNEEERSKVDD------LRG 103

Human   244 RGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILFVLLLFGIYGL 308
            ....|.:|:::     |.:.|.....:..:|.::...:...|  |.|.....:|....:..:.|:
  Fly   104 TPMSVGNLEEI-----IDDNHAIVSTSVGSEHYVSILSFVDK--DQLEPGCSVLLNHKVHAVVGV 161

Human   309 LKNPFLSVRFRTTTGLDSAVDPVQMKNV---TFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGG 369
            |.:           ..|..|..::::..   |:..:.|::...||::|.||. |.:|:.:..:|.
  Fly   162 LSD-----------DTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGI 215

Human   370 KLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCV 434
            |.|||::|.|||||||||||:|||.:....|....|||..:.::|.|...:|.|||.|:.:||.:
  Fly   216 KPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSI 280

Human   435 IFIDELDSVGGKRIESPM--HPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGR 497
            :||||:|:||.||.:|..  ....::|:.:||.::|||.....|.:|.|||..|.||.|||||||
  Fly   281 VFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGR 345

Human   498 FDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGK 562
            .|.::..|.||.|.:..|...:.:::...:.|:...:.......|||:::.:..:|.|.|..:.:
  Fly   346 IDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERR 410

Human   563 EMVTMKELEFSKDKIL 578
            ..||.::.:.||:.:|
  Fly   411 MKVTNEDFKKSKESVL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 29/67 (43%)
FtsH_fam 333..766 CDD:273520 91/252 (36%)
AAA 375..506 CDD:278434 60/132 (45%)
Peptidase_M41 586..764 CDD:279742
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 117/406 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.