DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and Rpt3R

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_649938.2 Gene:Rpt3R / 41190 FlyBaseID:FBgn0037742 Length:405 Species:Drosophila melanogaster


Alignment Length:257 Identity:90/257 - (35%)
Similarity:145/257 - (56%) Gaps:19/257 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   326 SAVDPVQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKLPKGILLVGPPGTGKTLLA 389
            |.:.|.:..::::..:.|::..|||::|.||. |.:.|.:..:|...|:|:||.||||.|||:||
  Fly   139 SMLSPDEKPDISYSDIGGLDIQKQEIREAVELPLTHAQLYKQIGIDPPRGVLLFGPPGCGKTMLA 203

Human   390 RAVAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHP 454
            :|||......|....||||.:.::|.|...:|:|||.||.|:|.:|||||:|::..||.::    
  Fly   204 KAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDLFRLAKQNSPSIIFIDEIDAIATKRFDA---- 264

Human   455 YSRQT---------INQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVK 510
               ||         :.:||.:||||.....:.:|.|||..:.||.||:||||.|.::.:|.||.:
  Fly   265 ---QTGADREVQRILLELLNQMDGFDETTNIKVIMATNRADTLDPALLRPGRLDRKIELPLPDRR 326

Human   511 GRTEILKWYLNKIKFDQSVDPE-IIARGTVGFSGAELENLVNQAALKAAVDGKEMVTMKELE 571
            .:..:.....:|:...:.||.| ||||.. ..|.|::..:..:|.:.|..:.:.:|..|:.|
  Fly   327 QKRLVFTTITSKMNVGEDVDLEDIIARPD-KISNADINAICQEAGMHAVRENRYVVNAKDFE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 26/64 (41%)
FtsH_fam 333..766 CDD:273520 88/250 (35%)
AAA 375..506 CDD:278434 58/139 (42%)
Peptidase_M41 586..764 CDD:279742
Rpt3RNP_649938.2 PTZ00454 20..405 CDD:240423 90/257 (35%)
AAA 189..322 CDD:278434 58/139 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.