DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and pch2

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster


Alignment Length:205 Identity:55/205 - (26%)
Similarity:94/205 - (45%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   375 ILLVGPPGTGKTLLARAVAGEADV----PFYYA------SGSEFDEMFVGVG--ASRIRNLFREA 427
            |||.||||||||.|.:|:|.:..:    .:.|.      |.|.|.:.|...|  .:::.|...|.
  Fly   169 ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAEL 233

Human   428 KA---NAPCVIFIDELDSVGGKR--IESPMHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEA 487
            .:   |..||: |||::|:...|  :.|.....:.:.:|.:|.::|..|....|:|:..:|..::
  Fly   234 VSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQS 297

Human   488 LDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEI-------------IARGTV 539
            :|.|.:  .|.|:::.:..|.:....||.|..|.::.....:..|:             :|..:|
  Fly   298 IDLAFV--DRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSV 360

Human   540 GFSGAELENL 549
            |.||..|..|
  Fly   361 GLSGRTLRKL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 14/19 (74%)
FtsH_fam 333..766 CDD:273520 55/205 (27%)
AAA 375..506 CDD:278434 42/147 (29%)
Peptidase_M41 586..764 CDD:279742
pch2NP_001287235.1 AAA 166..315 CDD:214640 42/148 (28%)
AAA 169..314 CDD:278434 42/147 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.