DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and CG4701

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:151/287 - (52%) Gaps:25/287 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   335 NVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKL---PKGILLVGPPGTGKTLLARAVAGE 395
            ::::..:.|::...|||:|.|.. :::.:.|:  ..||   |||:||.||||.||||:|:|:|.:
  Fly    91 DISWSDIAGLDGTIQELRETVVLPVRHRKLFS--RSKLWRAPKGVLLHGPPGCGKTLIAKAIAKD 153

Human   396 ADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTI 460
            |.:.|.........:.:.|........:|..||...||:|||||::|....| .|..|..:....
  Fly   154 AGMRFINLDVGVLTDKWYGESQKLATAVFTLAKKLQPCIIFIDEIESFLRMR-GSNDHEATAMIK 217

Human   461 NQLLAEMDGFKPNEG--VIIIGATNFPEALDNALIR--PGRFDMQVTVPRPDVKGRTEILKWYLN 521
            .|.:.:.||...|..  |:::||||.|:.||.|::|  |.:|  .:.||| |.: |.|||:..|.
  Fly   218 TQFMLQWDGLMSNTNICVLVLGATNRPQDLDKAILRRMPAQF--HIGVPR-DCQ-RREILQLILQ 278

Human   522 KIKFDQSVDPEIIARGTVGFSGAELENLVNQAA-------LKAAVDGKEMVTMKELEFS---KDK 576
            ..:...||:.:.:||.|:||||::|..|...|:       ::..::..|.:...::|:.   ||:
  Fly   279 TEQLSPSVNLKELARLTIGFSGSDLRELCRHASMYRMRQFMREKLNTGEEIGKDKIEWDFEVKDQ 343

Human   577 ILMGPERRSVEIDNKNKTITAYHESGH 603
            .|...|...:::::..|:::....|.|
  Fly   344 ALQEWEHLEIQMEDLLKSLSVMKASKH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 25/63 (40%)
FtsH_fam 333..766 CDD:273520 88/287 (31%)
AAA 375..506 CDD:278434 47/134 (35%)
Peptidase_M41 586..764 CDD:279742 3/18 (17%)
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 24/62 (39%)
AAA 130..265 CDD:214640 50/137 (36%)
AAA 133..265 CDD:278434 47/134 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.