DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and CG5776

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_001260420.1 Gene:CG5776 / 34680 FlyBaseID:FBgn0032450 Length:799 Species:Drosophila melanogaster


Alignment Length:263 Identity:95/263 - (36%)
Similarity:150/263 - (57%) Gaps:6/263 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   331 VQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAG 394
            ::..||.:..:.|..|.:..:|:.:|: |.:..||..||.|.|:|||:.||||..||::|:|:|.
  Fly   527 IECPNVQWSDIGGQSELRLAMQQAIEWPLLHADKFQRLGIKPPRGILMFGPPGCSKTMIAKALAT 591

Human   395 EADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIE----SPMHPY 455
            |:.:.|....|.|...|:||.....:|.:||:|:..||.::|.||:|::||:|.|    |.....
  Fly   592 ESKLNFLSIKGPELFSMWVGESERAVREVFRKARQVAPAIVFFDEIDAIGGERSEGDGSSSGSSV 656

Human   456 SRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYL 520
            ..:.:.|||.|:||.:..:.|.|:.|||.|:.:|.||:||||.|..:.|..|..:.|.||||..|
  Fly   657 KERVLTQLLTELDGVEALQNVTIVAATNRPDMIDKALLRPGRIDRILYVGLPQCEARREILKIKL 721

Human   521 NKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRS 585
            ..:.....||.|.:.:.|.|:||||::.:.::|||:|.....|...:|..:| :..:...|.|.|
  Fly   722 RAMPISNDVDMEKLVQLTEGYSGAEIQAVCHEAALRALEQSFEAEDVKWTDF-EHALKAVPPRTS 785

Human   586 VEI 588
            .|:
  Fly   786 PEL 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 25/64 (39%)
FtsH_fam 333..766 CDD:273520 95/261 (36%)
AAA 375..506 CDD:278434 54/134 (40%)
Peptidase_M41 586..764 CDD:279742 1/3 (33%)
CG5776NP_001260420.1 SpoVK 288..785 CDD:223540 93/258 (36%)
AAA 307..447 CDD:278434
AAA 572..707 CDD:278434 54/134 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.