DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L1 and CG4908

DIOPT Version :9

Sequence 1:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens
Sequence 2:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster


Alignment Length:357 Identity:84/357 - (23%)
Similarity:137/357 - (38%) Gaps:83/357 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   181 LYRHHSR-ALQSICSDLQY-----WPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVK-- 237
            |:|.|.. .|:..|.|..|     |.....:|..:.|...|..:|:.:..:..:.:..||..|  
  Fly    42 LFRRHCMITLEVPCRDKSYQWLLKWITIRGARKTQHLSVETNFVQNDNGTIKTSYDFIPSIGKHL 106

Human   238 -----GFLLRDRGSDVESLDKLM-------------KTKNI-----PEAHQDAFKTGFAEGFLKA 279
                 .::..:|..:.::||..|             ..|.|     .||.|           |..
  Fly   107 FQYKGNWIQVERTREQQTLDLHMGVPWETVTLTAFGNNKGIYFDILEEARQ-----------LAL 160

Human   280 QALTQKTNDSLRRTRLILFVLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGV 344
            :|...||              :|:...|....||...|.|..||      .|.:...|.:.:   
  Fly   161 EATEGKT--------------VLYTAMGAEWRPFGHPRRRRPTG------SVVLDRGTSQRI--- 202

Human   345 EEAKQELQEVVEFLKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFD 409
                  :.:..:|:|:...:|..|....:|.||.||||.||:....|:|||.:......:.||  
  Fly   203 ------IADCQDFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSE-- 259

Human   410 EMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHP-----YSRQTINQLLAEMDG 469
               .|:...|:.:|...|...:  :|.::::|:....|..:|...     .:|.|.:.||..:||
  Fly   260 ---RGLTDDRLNHLLNVAPEQS--IILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCLDG 319

Human   470 FKPNEGVIIIGATNFPEALDNALIRPGRFDMQ 501
            ....|..|:...||:.:.||.||:||||.|::
  Fly   320 VGSTEARIVFMTTNYIDRLDPALVRPGRIDLK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 17/63 (27%)
FtsH_fam 333..766 CDD:273520 47/174 (27%)
AAA 375..506 CDD:278434 41/132 (31%)
Peptidase_M41 586..764 CDD:279742
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 36/180 (20%)
RecA-like_BCS1 202..354 CDD:410918 46/166 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.