DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: POLD3 and Pol32

Sequence 1:NP_006582.1 Gene:POLD3 HGNCID:20932 Length:466 Species:Homo sapiens
Sequence 2:NP_001188816.1 Gene:Pol32 FlyBaseID:FBgn0283467 Length:431 Species:Drosophila melanogaster

Alignment Length:500 Identity:108/500 (22%)
Similarity:177/500 (35%) Gaps:118/500 (24%)


Human    10 IDEFVTDQNKIV-------TYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSL 67
            :|:.:.|.::.|       .|| |||      .:...:|..|:   :::....:....:||.|..
  Fly     7 LDDCMIDFDRCVLVTDLLEEYK-LSY------KEVNDVLEAYI---KEQEPATKFEKRFLVHGKR 61

Human    68 IQNGHSCHK--VAVVREDKLEAVKSKLAVTASIHVYSIQ-----KAMLKDSGPLFNTDYDILK-S 124
            ...|....:  .:||.|.:::...:|:. .|...:||::     ||......|:.:.:..:.| .
  Fly    62 KTQGSDSGEDLYSVVLESRMQDWLAKVQ-DAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVE 125

Human   125 NLQNCSKFSAIQCAAAVPRA--------------PAESSSSSKKFEQSHLHMSSETQANNELTTN 175
            ......|.        ||.|              .:|.|.|:.|.|.|...:.||     ...:.
  Fly   126 QRPGAGKI--------VPSANGTTPHNGVKSEPTKSEPSKSAVKLEPSKSSLKSE-----PAKSK 177

Human   176 GHGPPASKQVSQQPKGIMGMFASK---AAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSN 237
            ...|.|||...:..|......|||   ||||....|......|.:..:..|..:|:  ....:.|
  Fly   178 AEKPVASKSSPEDKKTSPKEQASKAKPAAAKKGSINSFFTAAASKPKDVKATPSKS--TSGTVDN 240

Human   238 FFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGK 302
            ||.|......|...:||...|::               |:.:..|::|||..| ...:|......
  Fly   241 FFKKQPAGAKKSPPESEDKSKKD---------------ASNSNKKEASKKKSP-SPTKKPTTANT 289

Human   303 RVALSDDETKETENMRKK--RRRIKLPESDSSEDEVFPDSP---GAYEAESPSPPPPPSPPLEPV 362
            .:.|.|:|:.|:.:..:|  ..|.|:.|||:..|:....|.   ...::|....||..|...|.:
  Fly   290 SMQLFDEESAESSDEEEKLDMLRRKVIESDNDSDQEKASSSKRRRISDSEDEEQPPKKSADEETI 354

Human   363 ---PKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSV 424
               .|.:.||                  .::||||.:|.::|::.      ....:..|.|.|..
  Fly   355 ALDEKMDTEP------------------ANETYLDEDGFVITQRK------PTKAQPANKKVSPK 395

Human   425 HRPPAMTVKKEPREERKG---PKKGTAALGKANRQVSITGFFQRK 466
            ...|....|..|...:.|   ||         .:|..|..||.:|
  Fly   396 AAAPVNKKKSPPSAAKAGKDAPK---------TKQAGIMNFFSKK 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
POLD3NP_006582.1 CDC27 19..466 CDD:286580 105/490 (21%)
Interaction with PCNA. {ECO:0000269|PubMed:11595739, ECO:0000269|PubMed:22148433} 456..466 4/10 (40%)
Pol32NP_001188816.1 CDC27 <153..431 CDD:286580 78/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28HEU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130668
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.