DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: STAMBP and CG2224

Sequence 1:NP_001340896.1 Gene:STAMBP HGNCID:16950 Length:424 Species:Homo sapiens
Sequence 2:NP_001263108.1 Gene:CG2224 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster

Alignment Length:439 Identity:190/440 (43%)
Similarity:273/440 (62%) Gaps:49/440 (11%)


Human     5 GDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITL 69
            |||.  |::|::.||..|:.:||::::|..||:|||.|::|||::|..|||.|:|||||.:|:||
  Fly    11 GDVE--PQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNHENAFILYLRYMTL 73

Human    70 FIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELAR 134
            ||||:.:|.||.| |..|.:|..:|:|:...|..|:|:|:||..|.:||.::  ...||||.:  
  Fly    74 FIEKIRQHPDYGS-VKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQREYEQF--LASKEAERV-- 133

Human   135 NMAIQQELEKEKQRVAQ-QKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVP 198
                 :|||:|::|..: |:|::.|:....|...:|      ...|.::     :|.| ..|..|
  Fly   134 -----KELERERERERERQRQKEREKAGSSAIPSLI------PANLHVL-----IDEG-NQPSAP 181

Human   199 DLEKPSLDVFPT----------------LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSES 247
            ||......|:|.                |..:|...:|..|..:|:    .||:.|| :.:.::|
  Fly   182 DLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNSKPS----FDRNQKP-SYNRTDS 241

Human   248 IPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCN 312
            : ....||.|.|||.....||:||.|||::.:||||:|.|.|.:|:..|||::.|:|....|.||
  Fly   242 L-LAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCN 305

Human   313 TENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFF 377
            |.:||::|.:|||..|||||||||||||||||||||||||||||:|:||::||||:||:..||||
  Fly   306 TMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAPKYNTTGFF 370

Human   378 KLTDH-GLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRA-VTITDLR 424
            .||.| ||:.|:.|||.|||||..|||||....|:.:.::| :.:.|||
  Fly   371 ILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLR 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
STAMBPNP_001340896.1 Interaction with CHMP3 1..127 55/122 (45%)
USP8_dimer 7..114 CDD:312504 50/107 (47%)
Interaction with STAM 227..231 1/4 (25%)
MPN_AMSH_like 254..424 CDD:163697 101/172 (59%)
JAMM motif. {ECO:0000255|PROSITE-ProRule:PRU01182} 335..348 13/13 (100%)
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108 49/104 (47%)
MPN_AMSH_like 247..419 CDD:163697 101/172 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330533416
eggNOG 1 0.900 E1_COG1310
Hieranoid 1 1.000
Homologene 1 1.000 H4719
Inparanoid 1 1.050 326 1.000 Inparanoid score I2442
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D411229at2759
OrthoFinder 1 1.000 FOG0001631
OrthoInspector 1 1.000 T609596
orthoMCL 1 0.900 OOG5_130679
Panther 1 1.100 LDO PTHR12947
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1402
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.