DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT7 and CCT1

Sequence 1:NP_006420.1 Gene:CCT7 HGNCID:1622 Length:543 Species:Homo sapiens
Sequence 2:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster

Alignment Length:550 Identity:197/550 (36%)
Similarity:298/550 (54%) Gaps:35/550 (6%)


Human    12 GTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAA 76
            ||..| |......|:.|...|:..|:::|||.|:||::||..|..|::|||||||:||:|.||||
  Fly    12 GTRQS-GASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAA 75

Human    77 KTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAV 141
            |.||::|:.||.|||||||||.:||||.||.....|::.:||..||..:|.|.:.|...|.|...
  Fly    76 KVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLT 140

Human   142 TVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA---VMMLDDLLQ----LKMIGIKK 199
            .  ..|::.:..|: ..|.|::|||:|.....||:.|||||   |.:.|...|    :|.|.:.|
  Fly   141 A--PVDELGRDSLI-NIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLK 202

Human   200 VQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQ 264
            ..|.:..:|.|:.|.|...|.:   .:..|||..|.|||.|:..|:....|...::.::..:..:
  Fly   203 AHGKSARESVLIPGYALNCTIA---SQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLE 264

Human   265 AIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGS 329
            ||...|.:|..:::..|..:|..|||....:.|:..:||.:.......||.:.|||....|.|.:
  Fly   265 AIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAA 329

Human   330 IQTSV------NALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERS 388
            ..||:      .:..|.::|......:.:|..:......|.......:.||||..:.:.:|.|||
  Fly   330 FITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERS 394

Human   389 LHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNA 453
            :|||:.:|:|.:::..||||||.:|..||.||.:::.::..::||.|..:||:|.:||:.|..||
  Fly   395 VHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNA 459

Human   454 GFDATNILNKLRARHAQGGT--------WYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAA 510
            ..|||:::.|||:.|....|        |.|:|:....:.||.:|.|.||||.:|.:|..|:|||
  Fly   460 AKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAA 524

Human   511 CLIVSVDETIK-NP-----RSTVDAPTAAG 534
            ..|:.:|:.|| ||     :|..|| .|||
  Fly   525 ITILRIDDMIKLNPEDKSGKSYADA-CAAG 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT7NP_006420.1 TCP1_eta 5..525 CDD:239456 191/540 (35%)
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 191/538 (36%)
TCP1_alpha 12..538 CDD:239451 190/533 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.