DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CEL and Gli

Sequence 1:NP_001798.3 Gene:CEL HGNCID:1848 Length:753 Species:Homo sapiens
Sequence 2:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster

Alignment Length:602 Identity:167/603 (28%)
Similarity:258/603 (43%) Gaps:110/603 (18%)


Human    36 VNKKLGLLGDSVDIFKGIPFAAPTK---ALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYG- 96
            |::.:|    ...:|.|||:|.|..   ..:.|:.|.||| .|:|.:|...|.|......:|.| 
  Fly   168 VDRVMG----ECSVFLGIPYALPPTFEGRFKPPRVHRGWQ-LLQAVDFGPACPQPVRYTGATKGI 227

Human    97 ---DEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIV 158
               ||||||||::.|:....|::..|||::|:||.|:.|:.:        |:.|..:|:..:|:|
  Fly   228 MDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASN--------LFQGHILASFYDVVV 284

Human   159 VTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQ 223
            ||.|||:|.||||||||.|.|||||:.||.||:.||..||..|.||.|:|||||..|||||..|.
  Fly   285 VTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLL 349

Human   224 TLSPYNKGLIRRAISQSGVALSPWVI------QKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTD 282
            .::|..:.::||.|:|||.||:.|.:      .:|.   ::.:.:.:||.:..:.::..||:   
  Fly   350 MVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNT---SRVLGQLLGCSIESSWKLVNCLR--- 408

Human   283 PRALTLAYKVPLAGLEY-PMLHYVGFVPVIDGDF-IPADPINLYANAADIDYIAGTNNMDGHIFA 345
                |......|...|: |.:....:.||:|.:| :|.|           |:..|....|.....
  Fly   409 ----TGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGD-----------DWYEGWREKDWRFLT 458

Human   346 SIDMPAINKG--NKKV-------TEE------------DFYKL------------VSEFTITKGL 377
            ......|..|  |:.:       |:|            .:|:|            |..:..|...
  Fly   459 QTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNP 523

Human   378 RGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTE----IALAQHRANAKSAKTYAYLF 438
            .|...........|....:....:...::..:|:.:..|.:    :.|.|      ....|.|:.
  Fly   524 NGVYEAIKYIYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQ------KVPVYMYVL 582

Human   439 SHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQ------------DRTVSKAMIAYWTNF 491
            :........|:|....|..:..::.|.|| ..|.:.|:            ||.:|...:..:|||
  Fly   583 NTTVEALNLPQWRKYPHDIERYFLTGAPF-MDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNF 646

Human   492 AKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQE 556
            |:.|:|. ....:..|::........||.|.....||.:....:|. ..:|| .|  ||||....
  Fly   647 ARYGNPT-PQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTE-CAFWT-QY--LPTVIGVL 706

Human   557 ATPVPPTGDSEATPVPP 573
            ....|||.:....|..|
  Fly   707 VPTYPPTTEYWWEPKEP 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CELNP_001798.3 Heparin-binding 21..121 32/92 (35%)
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745 5/16 (31%)
GliNP_476602.1 COesterase 134..695 CDD:278561 155/570 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.