DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsp68

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_524474.1 Gene:Hsp68 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster

Alignment Length:682 Identity:198/683 (29%)
Similarity:325/683 (48%) Gaps:99/683 (14%)


Human    33 LAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATL 97
            :..:.:|||:....|.:.:.| .:||:.|.:..|.||..|...::||..||:|.:....|||.::
  Fly     1 MPAIGIDLGTTYSCVGVFQYG-KVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPKNSV 64

Human    98 RYFQHLLGKQADNPHVALYQARFPEHELTFDPQ-RQTVHFQISSQLQFSPEEVLGMVLNYSRSLA 161
            ...:.|:|::.|:..:......:|...:..:.: :.:|.|:.:::. |||||:..|||...:..|
  Fly    65 FDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKC-FSPEEISSMVLTKMKETA 128

Human   162 EDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQ 226
            |.:....:||||||||.:||.::|:|...|..:||:.||::||:.||.||:||:    |.|...:
  Fly   129 EAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAYGL----DKNLKGE 189

Human   227 -NIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQ 290
             |::.:|:|.|:...:|:|..     |..:   .::|....|..|||.:.:    .||...|.|:
  Fly   190 RNVLIFDLGGGTFDVSILTID-----EGSL---FEVRSTAGDTHLGGEDFD----NRLVNHFAEE 242

Human   291 RKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADL 355
            .|.:..||:|.||||:.:|...|.|.|..||::.:...:|:.|.:..||.:||:|..|||||.||
  Fly   243 FKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARFEELCGDL 307

Human   356 FERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV 420
            |.....||::||:.|:|...:|..::||||:||:|:||.:|....|.:.|..:||.|||.|.||.
  Fly   308 FRNTLEPVEKALKDAKMDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLSINPDEAVAYGAA 372

Human   421 YQAAALS--KAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHS--LKHNKRVLFSRMGPYPQRKV 481
            .|||.||  |:.::|..::.|  |.|:    :..:|...|:.:  ::.|.|:      |..|.| 
  Fly   373 IQAAILSGDKSSEIKDVLLVD--VAPL----SLGIETAGGVMTKLIERNSRI------PCKQSK- 424

Human   482 ITFNRYSHD---FNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHF 543
             ||..|:.:   ....:..|:...  .:|..|.|:.:||     ||..:.:..|.     |...|
  Fly   425 -TFTTYADNQPAVTIQVFEGERAL--TKDNNVLGTFDLT-----GVPPAPRGVPK-----IDVTF 476

Human   544 NLDESGVLS---------------------------LDRVESVFETLVEDSAEEESTLTKLGNTI 581
            :||.:|:|:                           :||:.|..|...|:.......:.......
  Fly   477 DLDANGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEKYAEEDERHRQRIAARNQLE 541

Human   582 SSLFGGGTTPDAKENGTDTVQEEEESP-----AEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEP 641
            :.|||   ..:|.|||.|.:...::|.     :|..|.........|||.|..:::..|...|  
  Fly   542 TYLFG---VKEAAENGGDRISAADKSSIVERCSEAMKWLDSNTTAEKEEYEYKLKELEQFCSP-- 601

Human   642 KGDATPEGEKATEKENGDKSEAQKPSEKAEAG 673
                     ..|:...|.....|.|:...:||
  Fly   602 ---------IMTKMHKGGGDGQQAPNFGQQAG 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 196/678 (29%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 137/390 (35%)
PHA00666 601..>739 CDD:222808 15/79 (19%)
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 198/682 (29%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 139/394 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.