DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70-4

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster

Alignment Length:698 Identity:190/699 (27%)
Similarity:320/699 (46%) Gaps:127/699 (18%)


Human    36 MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYF 100
            :.:|||:....|.:.:.| .:||:.|.:..|.||..|...:.||..||:|.:....||..|:...
  Fly     7 VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70

Human   101 QHLLGKQADN----------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLN 155
            :.|:|::.|:          |...:.....|:.|:|:..:::|          |.|||:..|||.
  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKT----------FFPEEISSMVLT 125

Human   156 YSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKD 220
            ..:..||.:..:.:.:||||||.:||.::|:|...|..:|||.||::||:.||.|::||:.::. 
  Fly   126 KMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA- 189

Human   221 INTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAG 285
              ...:|::.:|:|.|:...:|::.      :.|:   .:::....|..|||.:.:    .||..
  Fly   190 --VGERNVLIFDLGGGTFDVSILSI------DDGI---FEVKSTAGDTHLGGEDFD----NRLVT 239

Human   286 LFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEE 350
            .|.::.|.:..||:..|.||:.:|.....|.|..||::.....:|:.|.:..||...:||..|||
  Fly   240 HFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEE 304

Human   351 LCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAA 415
            |.||||.....||::||:.|::....|..::||||:||:|:||.:|......:||.|:||.|||.
  Fly   305 LNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAV 369

Human   416 AMGAVYQAAAL--SKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQ 478
            |.||..|||.|  .|:.:|:..::.|  |.|:    :..:|...|:.|      ||..|....|.
  Fly   370 AYGAAVQAAILHGDKSQEVQDLLLLD--VTPL----SLGIETAGGVMS------VLIKRNTTIPT 422

Human   479 RKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTT--------VKLKGVGDSFKKYPDYE 535
            ::..||..||.:        ..|.|    ::|:..:...|        .:|.|:..:.:..|.  
  Fly   423 KQTQTFTTYSDN--------QPGVL----IQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQ-- 473

Human   536 SKGIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT 600
               |:..|::|.:|:|::        |.:|.|..:|:.:| :.|....|        :||:....
  Fly   474 ---IEVTFDIDANGILNV--------TALERSTNKENKIT-ITNDKGRL--------SKEDIERM 518

Human   601 VQEEEESPAEGSKDEPGEQVELKEEAEAPV--------EDGSQPPPPEPKGDATPEGEKATE--- 654
            |.|.|:...|..|.:  |.:..|...|:..        ||..:....:  .|.|...:|..|   
  Fly   519 VNEAEKYRNEDEKQK--ETIAAKNGLESYCFNMKATLDEDNLKTKISD--SDRTTILDKCNETIK 579

Human   655 ----KENGDKSEAQKPSEKAE-------------AG--PEGVAPAPEG 683
                .:..||.|.:...::.|             ||  |.|:...|.|
  Fly   580 WLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGG 627

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 184/684 (27%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 127/398 (32%)
PHA00666 601..>739 CDD:222808 24/114 (21%)
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 184/682 (27%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 129/401 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.