DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70-2

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_524339.1 Gene:Hsc70-2 FlyBaseID:FBgn0001217 Length:633 Species:Drosophila melanogaster

Alignment Length:801 Identity:192/802 (24%)
Similarity:342/802 (43%) Gaps:205/802 (26%)


Human    33 LAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATL 97
            :..:.:|||:....|.:.: ...:||:.|.:..|.||..|...|.||..||.|.:....|.|.|:
  Fly     4 IPAIGIDLGTTYSCVGVWQ-NSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVAMNAKNTV 67

Human    98 RYFQHLLGKQADN----------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGM 152
            ...:.|:|::.|:          |...:.:...|:.|:.|..:|:          :|:|||:..|
  Fly    68 FDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERK----------RFAPEEISSM 122

Human   153 VLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFR 217
            ||...|.:||.:....:||||:|||.:||.::|:|...|..:|||.||::||:.||.||:||:  
  Fly   123 VLTKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYGL-- 185

Human   218 RKDINTTAQ-NIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRE 281
              |.|...: |::.:|:|.|:...::::..     |..:   .:::....|..|||.:.:    .
  Fly   186 --DKNLKGERNVLIFDLGGGTFDVSVLSID-----EGSL---FEVKATAGDTHLGGEDFD----N 236

Human   282 RLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRV 346
            ||...|.|:.|.:...|::.|.||:.:|.....|.|..||::.:...:|:.|.:.:||.:|::|.
  Fly   237 RLVNHFAEEFKRKHKSDIKGNARALRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKISRA 301

Human   347 EFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINA 411
            .||||..|||.....||::||..|:|....|..|:||||:||:|::|::|....|.::|..:||.
  Fly   302 RFEELNMDLFRSTMQPVERALSDAKMDKKAIHDVVLVGGSTRIPKIQKLLQDLFGGKQLNLSINP 366

Human   412 DEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGI--HSLKHNKRVLFSRMG 474
            |||.|.||..|||.|:   .|....::|.::..: ...:..:|...|:  :.::.|.|:      
  Fly   367 DEAVAYGAAVQAAILT---GVGSSQIQDLLLVDV-APLSLGIETAGGVMTNLVERNARI------ 421

Human   475 PYPQRKVITFNRYSHDFN---FHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYES 536
            |..|:::  |..||.:.|   ..:..|:...  .:|..:.|:.|||     |:..:.:..|.   
  Fly   422 PCKQQQI--FTTYSDNQNAVTIQVYEGERAM--TKDNNLLGTFNLT-----GIPPAPRGVPQ--- 474

Human   537 KGIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDTV 601
              |:..|:|:..|:|::                                      :||:|     
  Fly   475 --IEVAFDLNADGILNV--------------------------------------NAKDN----- 494

Human   602 QEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKP 666
                                                       :|.:.||.|  .:.||....| 
  Fly   495 -------------------------------------------STGKSEKIT--ISNDKGRLSK- 513

Human   667 SEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDL 731
                                          .||              |::....:|.:   :.|.
  Fly   514 ------------------------------AEI--------------DRMLSEAEKYK---VEDD 531

Human   732 EKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKE 796
            .::||.::.|:|||:|:..:..: ......|.:|.:|.::..|.|:.::||:...: |.....:.
  Fly   532 RQRERVQSKNNLEAYIYACRQAV-DDAPSGVLSETERSKVRDKCSSEASWLDKNSL-AEKEEFES 594

Human   797 KLAELRKLCQGLFFRVEERKK 817
            .|.|.:::|..:..::...||
  Fly   595 HLKECQRICTPIMSKIHGGKK 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 167/653 (26%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 130/399 (33%)
PHA00666 601..>739 CDD:222808 14/138 (10%)
Hsc70-2NP_524339.1 PTZ00009 1..632 CDD:240227 192/802 (24%)
HSPA1-2_6-8-like_NBD 6..382 CDD:212675 132/403 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.