DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70Cb

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001189103.1 Gene:Hsc70Cb FlyBaseID:FBgn0026418 Length:836 Species:Drosophila melanogaster

Alignment Length:965 Identity:255/966 (26%)
Similarity:440/966 (46%) Gaps:164/966 (17%)


Human    33 LAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATL 97
            ::|:.:|.|:||..||..:.| .:|.:.|..|.|.||..|.....:|..|.:|.:..:.|.|.|:
  Fly     1 MSVIGIDFGNESCYVAAARSG-GIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNTV 64

Human    98 RYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQ----------TVHFQISSQLQFSPEEVLGM 152
            ..|:.|||::.::|||        :||||..|.|.          .|:: :.....|.||::..|
  Fly    65 GGFKRLLGRKFNDPHV--------QHELTSIPARVEARGDGSIGIKVNY-LGEDQHFGPEQLTAM 120

Human   153 VLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFR 217
            :....:..:....:..:.|.||..||||..|||:|:|.||::|||.||:|:|:.|||||:||.::
  Fly   121 LFTKLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYK 185

Human   218 RKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRER 282
            ........:|::|.|.|..|...:...:...|         |::....:|: :||.:::|.|.:.
  Fly   186 NDLFEDKPRNVIFVDFGHSSLQASACAFTKGK---------LKMLASTWDQ-IGGRDIDLALGDY 240

Human   283 LAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHM-AQIEGLMDDVDFKAKVTRV 346
            .|..|.|:.|    .:.:.|.||..:||.|..:||..:|||:..: ..||..:||:|..:.:.|.
  Fly   241 FAKEFQERYK----INAKTNARANLRLLTEIEKLKKQMSANSTKLPLNIECFLDDIDVSSSMQRS 301

Human   347 EFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINA 411
            :.|||||.:.:||....::.|..:::.||:|..|.:|||::|:|.|:: |::.|..:.....:|.
  Fly   302 QMEELCAPVLQRVEQTFKRLLAESKLQLDDIHSVEIVGGSSRIPSVKQ-LIEQVFNKPASTTLNQ 365

Human   412 DEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPY 476
            |||.:.||..|.|.:|.|.:|:.|.|.|...|.:.|.:..|....||       :..:|.:....
  Fly   366 DEAVSRGAALQCAIMSPAVRVREFGVTDIQNYAVKVLWDSEGSAAPG-------EIEIFPQYHAS 423

Human   477 PQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRV-FGSQNLTTVKLKGVGDSFKKYPDYESKGIK 540
            |..:::|.|| ...||..|.||.         :| :..|.:...|:|.|    |.....|.:.:|
  Fly   424 PFSRLLTINR-KGPFNVSIVYGQ---------QVPYPDQTIGVWKVKDV----KPTERGEGQDVK 474

Human   541 AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDTVQEEE 605
            ....::.:|::.:...     ||||....||:.                                
  Fly   475 LKVRINNNGIVLISSA-----TLVEKKEAEEAA-------------------------------- 502

Human   606 ESPAE--GSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKPSE 668
             :.||  .|:::||:|.....|.    .||.|        :|..|.|     ::.:.|.|..|  
  Fly   503 -AAAEQAASEEKPGDQTNNTGEP----ADGQQ--------EAYCENE-----DDNNTSTASSP-- 547

Human   669 KAEAGPEGVAPAPEG------EKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLT 727
                |.:|.|...:|      :||:|.::    ..|:.:|.......  |.| |:...|:...:.
  Fly   548 ----GGQGWAQRVKGWFGSGADKKKKASK----ATELPLECTTHGFS--PVD-LSNYTQQESKMI 601

Human   728 LRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTV 792
            ..|.::.||..|.|:||.|:::.::||....::....|.:||:|..:|:....||.::|......
  Fly   602 GNDQKETERIDAKNALEEFVYDMRNKLQGGPFERYVVEAEREKIVSQLNDLENWLYEDGEDCERD 666

Human   793 MLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSM-------FLKGARLIPEMDQIFT 850
            :...:|..|.:....:..|..:.::.|   :|.|.|.|..::       |.||   :|:.|.: |
  Fly   667 IYTSRLQALHQKTDPIKLRASDYEQGP---AAFDELKNSIAIARLAVAEFRKG---VPKYDHL-T 724

Human   851 EVEMTTLEKVINETWAWKNATLAEQAKLPAT-EKPVLLSKDIEAKMMALDREVQYLLNKAKFTKP 914
            |.|...:.:..::..:|.:|.|.:..:.|.| :.||.:|. :..::..|:..|..::|:|   ||
  Fly   725 ETEFINISETADKAQSWLDANLPKFTQSPRTADSPVQISA-VRQEVQTLNSCVSSVINRA---KP 785

Human   915 RPRPKDKNGTRAEPPLNASASDQ--GEKVIPPAGQTEDAEPISEPEKVETAGSEP 967
            :|.|    ...|.||.:.:.::|  ||    ||..:.|...:....: ..||::|
  Fly   786 KPTP----AKTATPPKDEANAEQNGGE----PAANSGDKMDVDNNGQ-SAAGNDP 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 180/651 (28%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 126/399 (32%)
PHA00666 601..>739 CDD:222808 32/146 (22%)
Hsc70CbNP_001189103.1 HSPA4_like_NDB 2..381 CDD:212670 128/404 (32%)
HSP70 3..682 CDD:278441 213/793 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.