DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70-1

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_524063.1 Gene:Hsc70-1 FlyBaseID:FBgn0001216 Length:641 Species:Drosophila melanogaster

Alignment Length:798 Identity:198/799 (25%)
Similarity:323/799 (40%) Gaps:209/799 (26%)


Human    33 LAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATL 97
            |..:.:|||:....|.:.:.| .:||:.|.:..|.||..|...|:||..||:|.:....||..|:
  Fly     4 LPAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTI 67

Human    98 RYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQ-FSPEEVLGMVLNYSRSLA 161
            ...:.|:|::.|:..|......:| .|:..:..:..:..:...:.: |.||||..|||...|..|
  Fly    68 FDAKRLIGRRFDDATVQSDMKHWP-FEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETA 131

Human   162 EDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQ 226
            |.:....:.|||:|||.:||.::|:|...|..:|||.||::||:.||.|::||:.::   .|:.:
  Fly   132 EAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQ---GTSER 193

Human   227 NIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQR 291
            |::.:|:|.|:...:::|.      |.|:   .:::....|..|||.:.:.||.......|..:.
  Fly   194 NVLIFDLGGGTFDVSVLTI------EDGI---FEVKATAGDTHLGGEDFDNRLVNHFVQEFQRKH 249

Human   292 KGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLF 356
            |    ||:.:|.||:.:|.....|.|..||::.....:|:.|.:.|||...|||..||||..|||
  Fly   250 K----KDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNGDLF 310

Human   357 ERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVY 421
            .....||.:||:.|:|...:|..::||||:||:|:||.:|......:||.|:||.|||.|.||..
  Fly   311 RGTMEPVAKALRDAKMDKGQIHDIVLVGGSTRIPKVQRLLQDFFNGKELNKSINPDEAVAYGAAV 375

Human   422 QAAAL--SKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHS--LKHNKRVLFSRMGPYPQRKVI 482
            |||.|  .|:..|:..::.|  |.|:    :..:|...|:.:  :|.|..:      |..|.::.
  Fly   376 QAAILHGDKSEAVQDLLLLD--VTPL----SLGIETAGGVMTTLIKRNTTI------PTKQTQIF 428

Human   483 TFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDE 547
            |            .|.|                                              ::
  Fly   429 T------------TYAD----------------------------------------------NQ 435

Human   548 SGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGS 612
            .|||.     .||        |.|..:|:..|::.                              
  Fly   436 PGVLI-----QVF--------EGERAMTRDNNSLG------------------------------ 457

Human   613 KDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGE-------------KATEKENGDKSEAQ 664
                      |.|..|        .||.|:|  .|:.|             .|.||..|.::...
  Fly   458 ----------KFELSA--------IPPAPRG--VPQVEVTFDIDANGILNVTALEKSTGKENRIT 502

Human   665 KPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLR 729
            ..::|.....|.:               .|||.:                  |::.::      .
  Fly   503 ITNDKGRLSKEDI---------------ERMVND------------------AEAYRQ------A 528

Human   730 DLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVML 794
            |.::::|..|.|.||::.|:.:..|.........:...||.|..:.|....|| |....|.....
  Fly   529 DEQQRDRINAKNQLESYCFQLRSTLDDEHLSSRFSPADRETIQQRSSETIAWL-DANQLAERQEF 592

Human   795 KEKLAELRKLCQGLFFRV 812
            :.|..||.::|..:..|:
  Fly   593 EHKQQELERICSPIITRL 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 171/655 (26%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 132/389 (34%)
PHA00666 601..>739 CDD:222808 21/151 (14%)
Hsc70-1NP_524063.1 PTZ00009 1..641 CDD:240227 198/799 (25%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 134/393 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.