DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70-5

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001286414.1 Gene:Hsc70-5 FlyBaseID:FBgn0001220 Length:686 Species:Drosophila melanogaster

Alignment Length:772 Identity:192/773 (25%)
Similarity:329/773 (43%) Gaps:176/773 (23%)


Human    34 AVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMAIKNPKATL 97
            ||:.:|||:.:..:|::: |...:::.|.|..|.||..|.. |:.||..|..|...|:.|...|.
  Fly    53 AVIGIDLGTTNSCLAVME-GKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTF 116

Human    98 RYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQI------------SSQLQFSPEEVL 150
            ...:.|:|::.|:|.|        :.::|      .:.:::            :....:||.::.
  Fly   117 YATKRLIGRRFDDPEV--------KKDIT------NLSYKVVKASNGDAWVSSTDGKVYSPSQIG 167

Human   151 GMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGV 215
            ..:|...:..||.:...|:|:||:|||.:||.::|:|...|.::|||.||::||:.||.||:||:
  Fly   168 AFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGM 232

Human   216 FRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLR 280
            .:.:|     :.|..||:|.|:...:|:..|         :...:::....|..|||.:.:..:.
  Fly   233 DKTED-----KIIAVYDLGGGTFDISILEIQ---------KGVFEVKSTNGDTLLGGEDFDNHIV 283

Human   281 ERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDV----DFKA 341
            ..|...|    |.....|:|::..||.:|...|.:.|..||::......:..|..|.    ....
  Fly   284 NFLVAEF----KKDSGIDIRKDNIAMQRLKEAAEKAKCELSSSQQTDINLPYLTMDAAGPQHMNL 344

Human   342 KVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELG 406
            |:||.:.|.|..||.:|...|.|:||..||:|..||.:|:||||.||:|:||..:.:..|::. .
  Fly   345 KLTRSKLESLVGDLIKRTIQPCQKALSDAEVSKSEIGEVLLVGGMTRMPKVQSTVQELFGRQP-S 408

Human   407 KNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVE-----FTREVEEEPGIHSLKHNK 466
            :::|.|||.|:||..|...|  |..|...::.|.....:.:|     |||               
  Fly   409 RSVNPDEAVAVGAAVQGGVL--AGDVTDVLLLDVTPLSLGIETLGGVFTR--------------- 456

Human   467 RVLFSRMGPYPQRKVITFNRYSH---DFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSF 528
              |.||....|.:|...|:..|.   .....::.|:...  ..|.::.||..|.     |:..:.
  Fly   457 --LISRNTTIPTKKSQVFSTASDGQTQVEIKVHQGEREM--ANDNKLLGSFTLV-----GIPPAP 512

Human   529 KKYPDYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDA 593
            :..|.     |:..|::|.:|:             |..||:::.|..:....|.|  .||.:.|.
  Fly   513 RGVPQ-----IEVVFDIDANGI-------------VHVSAKDKGTGKEQQIVIQS--SGGLSKDE 557

Human   594 KENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENG 658
            .||...  :.||.:.|:..|   .|.:|:..:.|:.|.|                          
  Fly   558 IENMIK--KAEEYATADKQK---RELIEIVNQGESIVHD-------------------------- 591

Human   659 DKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKL 723
              :|.:....|::      .||.|.||.:|.               :.||..|           |
  Fly   592 --TETKMEEFKSQ------LPAEECEKLKKE---------------IADLRTL-----------L 622

Human   724 QDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST 780
            .:....|||  |..||.:||:    ::..||::..|:::|.|.:....:|...::|:
  Fly   623 ANKETADLE--EVRKATSSLQ----QSSLKLFELAYKKMSAERESNAGAGSSDSSSS 673

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 166/662 (25%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 117/405 (29%)
PHA00666 601..>739 CDD:222808 26/138 (19%)
Hsc70-5NP_001286414.1 dnaK 51..666 CDD:234715 190/764 (25%)
HSPA9-like_NBD 51..428 CDD:212683 119/409 (29%)
Syntaphilin <566..>642 CDD:291936 29/145 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.