| Sequence 1: | XP_005271449.1 | Gene: | HYOU1 / 10525 | HGNCID: | 16931 | Length: | 1000 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001285139.1 | Gene: | Hsc70-3 / 32133 | FlyBaseID: | FBgn0001218 | Length: | 656 | Species: | Drosophila melanogaster | 
| Alignment Length: | 694 | Identity: | 191/694 - (27%) | 
|---|---|---|---|
| Similarity: | 326/694 - (46%) | Gaps: | 123/694 - (17%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human    35 VMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMAIKNPKATLR 98 
Human    99 YFQHLLGKQADNPHVALYQARFPEHELTFDP-----QRQTVHFQISSQ---LQFSPEEVLGMVLN 155 
Human   156 YSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKD 220 
Human   221 INTTAQNIMFYDMGSGSTVCTIVT-----YQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLR 280 
Human   281 ERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTR 345 
Human   346 VEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNIN 410 
Human   411 ADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGP 475 
Human   476 YPQRKVITFNRYS---HDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESK 537 
Human   538 GIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTK----LGNTISSLFGGGTTP------- 591 
Human   592 -DAKENGTD--TVQEEEESPAE------------GSKDEPGEQV--ELKEEAEAPVEDGSQPPPP 639 
Human   640 EPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPEGVAPAPEG 683 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| HYOU1 | XP_005271449.1 | HSP70 | 35..672 | CDD:278441 | 184/681 (27%) | 
| NBD_sugar-kinase_HSP70_actin | 36..424 | CDD:302596 | 124/401 (31%) | ||
| PHA00666 | 601..>739 | CDD:222808 | 26/97 (27%) | ||
| Hsc70-3 | NP_001285139.1 | HSPA5-like_NBD | 29..403 | CDD:212681 | 125/402 (31%) | 
| PTZ00009 | 32..643 | CDD:240227 | 186/688 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0443 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||