DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and Hsc70-3

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001285139.1 Gene:Hsc70-3 FlyBaseID:FBgn0001218 Length:656 Species:Drosophila melanogaster

Alignment Length:694 Identity:191/695 (27%)
Similarity:326/695 (47%) Gaps:123/695 (18%)


Human    35 VMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTL-KENERFFGDSAASMAIKNPKATLR 98
            |:.:|||:....|.:.|.| .:||:.|.:..|.||..|.. .:.||..||:|.:....||:.|:.
  Fly    31 VIGIDLGTTYSCVGVYKNG-RVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVF 94

Human    99 YFQHLLGKQADNPHVALYQARFPEHELTFDP-----QRQTVHFQISSQ---LQFSPEEVLGMVLN 155
            ..:.|:|::..:.:|        :|::.|.|     :....|..:.:.   ..|:|||:..|||.
  Fly    95 DAKRLIGREWSDTNV--------QHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISAMVLG 151

Human   156 YSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKD 220
            ..:..||.:..:.:..||:|||.:||.|:|:|...|..:|||:|:::||:.||.|::||:.:::.
  Fly   152 KMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAIAYGLDKKEG 216

Human   221 INTTAQNIMFYDMGSGSTVCTIVT-----YQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLR 280
                .:|::.:|:|.|:...:::|     :::|.|..              |..|||.:.:.|:.
  Fly   217 ----EKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNG--------------DTHLGGEDFDQRVM 263

Human   281 ERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTR 345
            :....|:    |.::.||:|::.||:.||.||..:.|..||.:.....:||...:..||...:||
  Fly   264 DHFIKLY----KKKKGKDIRKDNRAVQKLRREVEKAKRALSGSHQVRIEIESFFEGDDFSETLTR 324

Human   346 VEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNIN 410
            .:||||..|||.....|||:.|:.|:|:..::.:::||||:||:|:||:::....|.:|..:.||
  Fly   325 AKFEELNLDLFRSTLKPVQKVLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGKEPSRGIN 389

Human   411 ADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGP 475
            .|||.|.||..||..||........|:.|  |.|:    |..:|...|:.:      .|..|...
  Fly   390 PDEAVAYGAAVQAGVLSGEQDTDAIVLLD--VNPL----TMGIETVGGVMT------KLIPRNTV 442

Human   476 YPQRKVITFNRYS---HDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESK 537
            .|.:|...|:..|   |.....:..|:...  .:|..:.|..:||     |:..:.:..|.    
  Fly   443 IPTKKSQVFSTASDNQHTVTIQVYEGERPM--TKDNHLLGKFDLT-----GIPPAPRGIPQ---- 496

Human   538 GIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTK----LGNTISSLFGGGTTP------- 591
             |:..|.:|.:|:|.:             |||::.|..|    :.|..:.|     ||       
  Fly   497 -IEVSFEIDANGILQV-------------SAEDKGTGNKEKIVITNDQNRL-----TPEDIDRMI 542

Human   592 -DAKENGTD--TVQEEEESPAE------------GSKDEPGEQV--ELKEEAEAPVEDGSQPPPP 639
             ||::...:  .::|..||..|            |.||:.|.::  :.|.:.|:.:::..:....
  Fly   543 RDAEKFADEDKKLKERVESRNELESYAYSLKNQIGDKDKLGAKLSDDEKNKLESAIDESIKWLEQ 607

Human   640 EPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPEGVAPAPEG 683
            .|  ||.||..|..:|:.  ::..|....|...|..| ||.|||
  Fly   608 NP--DADPEEYKKQKKDL--EAIVQPVIAKLYQGAGG-APPPEG 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 184/682 (27%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 125/402 (31%)
PHA00666 601..>739 CDD:222808 26/98 (27%)
Hsc70-3NP_001285139.1 HSPA5-like_NBD 29..403 CDD:212681 126/403 (31%)
PTZ00009 32..643 CDD:240227 187/689 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.