DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HYOU1 and CG2918

Sequence 1:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001162645.1 Gene:CG2918 FlyBaseID:FBgn0023529 Length:923 Species:Drosophila melanogaster

Alignment Length:979 Identity:421/980 (43%)
Similarity:579/980 (59%) Gaps:78/980 (8%)


Human    18 LVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFG 82
            |::.|||. :|||...||||||||||.|||.:|.|||||||.||:||:||||.|:..::..|..|
  Fly     6 LLSALLAG-IALSQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIG 69

Human    83 DSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPE 147
            :.|.::.||:|.:...|...||||..|||.|.||:.|||.:.:..||:|.||.|:.|...:||.|
  Fly    70 EDAQTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVE 134

Human   148 EVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALS 212
            |::..:|..::..|::..:|||.:.|:|||.:|.||||.|:|.||::|.|||||||||..|.||:
  Fly   135 ELVAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVALN 199

Human   213 YGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEA-GMQPQLQIRGVGFDRTLGGLEME 276
            ||||.|.:||.|||..:|||||:..|...:|:||:||.|:. .:.|.:|:.|||:||||||||::
  Fly   200 YGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTREINPVVQVLGVGYDRTLGGLEIQ 264

Human   277 LRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKA 341
            ||||:.||..||..:|.:  .||..:|||:|||.:||.|||.|||||.:..||||.|::|:|||.
  Fly   265 LRLRDYLAQEFNALKKTK--TDVTTSPRALAKLFKEAGRLKNVLSANTEFFAQIENLIEDIDFKL 327

Human   342 KVTRVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELG 406
            .|||.:.|:||.||:.|...|:::||.|:.:|||.|.||||.||.||||||||. :|||.|:|||
  Fly   328 PVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTRVPRVQET-IKAVIKQELG 391

Human   407 KNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGI-HSLKHNKRVLF 470
            ||:||||:|.|||||:||.||..||||.|||:||.::|:.|.|    |.:||. .::|..||.||
  Fly   392 KNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSF----ERDPGDGAAVKQVKRALF 452

Human   471 SRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPD-- 533
            :.|.||||:||||||:::.||.|::||.||.....|::...||.|:|.|:||.|.:..:|...  
  Fly   453 ALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALGSLNVTKVQLKQVKELLEKSKKEL 517

Human   534 YESKGIKAHFNLDESGVLSLDRVESVFE-TLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENG 597
            .::|||||:|.||:||:.....||.|:| ...||.|:|:|||:|.|:|:|.||    |.:.:|..
  Fly   518 VDNKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDADEDSTLSKFGSTLSKLF----TKEGEEKK 578

Human   598 TDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSE 662
            .::.|||    |..:.:||.:                           :.:.|||.|:   |.|:
  Fly   579 DNSEQEE----AANAGEEPSK---------------------------SEDNEKAKEE---DASK 609

Human   663 AQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLT 727
            .||..|..:...|.     :.|..:....|..:..|...:.||    .|......|||.||..:.
  Fly   610 EQKSEESTKQDTEA-----KNETIKLVTVKSPVTYESQTQFVV----PLVGSAYDQSVAKLAAIN 665

Human   728 LRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTV 792
            ..:.::...|.|.|:|||.|.|.|.||.:..|.:.:|.|::|::..:.|....||.::.......
  Fly   666 KAEEQRVRLESAFNALEAHIIEVQQKLDEESYAKCATAEEKEKLLAECSTLGEWLYEDLEDPKAE 730

Human   793 MLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLI-----PEMDQIFTEV 852
            :.:||||:|:||......|..|.::.||.:.||..:::.:..||...|.:     ||.| :||:|
  Fly   731 IYEEKLAQLKKLSNVFLARHWEHEERPEAIKALKGMIDGAEKFLVTGRNLTKDTNPEKD-VFTQV 794

Human   853 EMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAKFTKPRPR 917
            |:.||:|||.||.||.....|.|.||.......|..|||..||..|||||:||:||.|..||:.:
  Fly   795 EIDTLDKVITETNAWLKTETAAQKKLAKNADIRLTVKDITDKMSLLDREVKYLVNKIKIWKPKVK 859

Human   918 PKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISE-PEKVETAGSEPGDTEPLELGGPGAE 981
            |..:...:.|..:.||.|....|       :||||...| ..|.|....||.|    |:....||
  Fly   860 PAAEKEKKKEEEVVASGSGDDTK-------SEDAEQQQEQATKEEQQEQEPVD----EITPTPAE 913

Human   982 PEQK 985
            .|.|
  Fly   914 EETK 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 308/642 (48%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 212/389 (54%)
PHA00666 601..>739 CDD:222808 28/138 (20%)
CG2918NP_001162645.1 HSP70 22..625 CDD:278441 309/653 (47%)
HYOU1-like_NBD 23..409 CDD:212672 212/389 (54%)
TAF4 <572..>627 CDD:296797 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C337772039
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 1 1.000 H4658
Inparanoid 1 1.050 668 1.000 Inparanoid score I730
Isobase 1 0.950 0 Normalized mean entropy S2181
OMA 1 1.010
OrthoDB 1 1.010 D125779at33208
OrthoFinder 1 1.000 FOG0002912
OrthoInspector 1 1.000 T1072476
orthoMCL 1 0.900 OOG5_128359
Panther 1 1.100 LDO PTHR45639
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3997
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.