DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MERTK and side-VII

Sequence 1:NP_006334.2 Gene:MERTK HGNCID:7027 Length:999 Species:Homo sapiens
Sequence 2:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster

Alignment Length:1002 Identity:182/1003 (18%)
Similarity:308/1003 (31%) Gaps:393/1003 (39%)


Human    84 TSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGK-------ELLGAH 141
            :|:.||.:|....:..||       :.:...|:::..:..:...:.|::|.|       ::....
  Fly    16 SSIGSKDVPIHQIESIVG-------ENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSIDIRAGV 73

Human   142 HAITQFYPDDEVTAIIASF---------SITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLP 197
            ....:.:.||.|....|.|         ||.:.|.||:|:|.|::.....:.::..|.:.|...|
  Fly    74 SKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINSRIRLNVISPP 138

Human   198 HFTKQPESMNVTRNTA---------FNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVL---- 249
            ......:|.||.|:|.         .:|.||.:|......|.|.::...:       |..|    
  Fly   139 KQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEI-------PCELSHLA 196

Human   250 ---------TVPGLTEMAV---FSCEA-HNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSIL 301
                     |:|.|....:   .:|.| .:.:...|...|||::...|     ::||...||   
  Fly   197 GGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAP-----LNIRLLGAH--- 253

Human   302 ISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIG 366
                                   .|||.|                      ..|.:         
  Fly   254 -----------------------QPLSAG----------------------RRYDL--------- 264

Human   367 WSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGI 431
                   :..|.....|:|                 |.|                    ||: ||
  Fly   265 -------LCQSAGSRPPAV-----------------ITW--------------------WQN-GI 284

Human   432 SKELLEEV-----GQNGSRARISVQVHNA----TCTVRIAAVTRGGVGPFSDPVKIFIPAHGW-- 485
            ..|...|.     .|..|...||:...:|    :|.....||.       |:|::     .||  
  Fly   285 RLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVP-------SEPLE-----DGWKL 337

Human   486 -VDYAPSSTPAPGNA-DPVL------IIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTEED 542
             :.|.|.:....|.: ||..      :.|.|        |::         .....|...:...:
  Fly   338 DIQYVPEAYVRLGTSLDPSTLREGTDVYFDC--------LVM---------AHPNVFRIEWRHNE 385

Human   543 SELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKIL-------------G 594
            ..|..|.                |||           |:|..:.|:|..:.             .
  Fly   386 QPLSHNI----------------SLG-----------VIISNHSLVLQGVTRATAGNYSCVGFNA 423

Human   595 EGE-----------FGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIE---EFLSEAACMKDFS 645
            |||           :......|.|:..|.:.:...|.|...:::.||:|   .|.:.|..: |.:
  Fly   424 EGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESI-DVA 487

Human   646 HPNVIRLLGVCIEMSSQGIPKPMVILPF--MKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIA 708
            ..::||          .|....:...|.  :.||   |.|..:..:.|.:.:|    ..|.: ||
  Fly   488 TNHIIR----------SGTTSIVTYTPITELDYG---TLLCLASNKIGKQRVP----CVFHI-IA 534

Human   709 LGMEYLSNRNFLHRDLAARNCMLRD----DMTVCVAD---FGL--SKKIYSGDYYRQ-------G 757
            .|           |.....||.:.:    .:||..:|   .||  |..:...|.|.|       .
  Fly   535 AG-----------RPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITS 588

Human   758 RIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQP 822
            .|.|..|..::..|    :|  :.:::||.       |:|.:. |.:.|..|         |:.|
  Fly   589 TIPKFTVPGLSPGS----IY--RLNIYAFN-------TKGRSD-PAIVNAAM---------LRMP 630

Human   823 EDCL--DELYEIMYSCWRTDPLDRPTFSV-LRLQLEKLLESLPDV------------RNQADVIY 872
            |..|  ::.:.:     |.:.|..|..|: :.|.|..|:..|..:            |.|.::  
  Fly   631 EKQLTSEQTHNL-----RAELLFSPVMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKEL-- 688

Human   873 VNTQLLESSEGLAQGSTLAPLDL--------------------NIDPDSIIASCTPRAAISVVTA 917
                   |:|.:::..:..|.|.                    :|:||....|...|..||.:..
  Fly   689 -------SNENISRDESPGPSDKSSGSKEVDDCDEKNPDVVPESIEPDEQAESIRKRQQISTIDT 746

Human   918 EVHDSKPHEGRYILNGGSEEWEDLTSA 944
               :..|:.|.::     .|.:.||:|
  Fly   747 ---NRSPNRGIFV-----NEQQHLTAA 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MERTKNP_006334.2 IG 111..193 CDD:214652 18/98 (18%)
Ig 111..176 CDD:143165 17/81 (21%)
Ig2_Tyro3_like 199..279 CDD:143226 22/106 (21%)
IG_like 203..280 CDD:214653 22/103 (21%)
FN3 284..378 CDD:238020 11/94 (12%)
FN3 386..478 CDD:238020 18/101 (18%)
PTKc_Mer 579..862 CDD:271106 68/331 (21%)
Pkinase_Tyr 587..854 CDD:285015 63/315 (20%)
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 20/109 (18%)
V-set 32..134 CDD:284989 20/109 (18%)
IGc2 160..>214 CDD:197706 11/61 (18%)
Ig 262..328 CDD:299845 20/127 (16%)
IG_like 264..323 CDD:214653 17/113 (15%)
IGc2 360..425 CDD:197706 14/109 (13%)
Ig_3 456..519 CDD:290638 16/77 (21%)
FN3 538..620 CDD:238020 21/96 (22%)
FAM176 643..741 CDD:291517 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.