DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP8A1 and CG33298

Sequence 1:XP_011511917.1 Gene:ATP8A1 HGNCID:13531 Length:1171 Species:Homo sapiens
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1335 Identity:409/1336 (31%)
Similarity:642/1336 (48%) Gaps:271/1336 (20%)


Human     3 TMRRTVSE---IRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQ---PQLTK-------FCNNHV 54
            |:|||.:.   .|.....|...|...|::       .||:..|.   |:..|       |..|.:
  Fly   198 TLRRTEAPPWWKRLTLCNYNTGDKFEERS-------YRTVVPNHTVPPKTPKRDHPNGQFVGNKI 255

Human    55 STAKYNIITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIE 119
            .|.||.:::|:|:.|..||.|.||.:|:||.||..:|::|..|:...::|:||:|.|.|:|::.|
  Fly   256 RTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFE 320

Human   120 DIKRHKADNAVNKKQTQVL--RNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAMCY 182
            |.:|..:|..:|....:|.  ....::.|.|:::.|||||.:...|.:|||.:||.:|:||.:||
  Fly   321 DRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCY 385

Human   183 IETSNLDGETNLKIRQGLPATSDIKDVDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGA 247
            |:|.:||||||||.|:.:....:::.:....:...|:|.::|...||.|.|.:.......||:..
  Fly   386 IDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPIST 450

Human   248 DQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVC 312
            :.:|||.::|:||.::.|||||.||:||.|.|::.|..|.|.||:..|:.::....||:.:.:|.
  Fly   451 ECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVG 515

Human   313 SVGSAIWNRRHSGKDWYLNLNYGGASNFGLN------FLTFIILFNNLIPISLLVTLEVVKFTQA 371
            ::|..:|....:    :..:.|...:....|      |.|:|::...:||:||.||:|:.|..|.
  Fly   516 AIGCRMWLSSFT----HFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQV 576

Human   372 YFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVP- 435
            :.|:.::|:....|:.....|..|:.|||||:::||:|||||||.|.|.|::|.:.|..|.|.| 
  Fly   577 FHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPS 641

Human   436 EPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHT----AVPERE- 495
            |.|.....|.........::...||.:.|.......|.|..|.|||.::|:|:|    |.|.|: 
  Fly   642 ELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDM 706

Human   496 ----------------------------------------------------------------- 495
                                                                             
  Fly   707 MNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAES 771

Human   496 ----------------------------------------------------------------- 495
                                                                             
  Fly   772 RSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVI 836

Human   496 GDKI----------------------------------IYQAASPDEGALVRAAKQLNFVFTGRT 526
            ..||                                  :|:|.||||.|||.||...:.....|:
  Fly   837 NSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRS 901

Human   527 PDSVIID--SLGQEERYELLNVLEFTSARKRMSVIVR-TPSGKLRLYCKGADTVIYDRLAETSK- 587
            |:.:::.  ..|....||:|.||.|.|:||.||::|| ..|.::.||.||||:.|...|...|. 
  Fly   902 PNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHN 966

Human   588 -----YKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRASTSVQNRLLKLEESYELI 647
                 .:|.|.:.|:::|.||||.|..|...::.:|:.:|.|.:|....|::||..:|.:|:..:
  Fly   967 SPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKL 1031

Human   648 EKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLKKNMGMIVIN 712
            |.||.|||||.|||:|||.|||||.:|:.|.|.:|:|||||.||||||.:|.||..:.|.:|.:.
  Fly  1032 ESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLT 1096

Human   713 EGSLDVEDRAVEGTRETLSRHCTT----LGDALRKENDFALIIDGKTLKYALTFGVRQY--FLDL 771
            ..|.|..:.|:......:....||    .|.:|||:.. ||::|||||.:.|....:..  ||.|
  Fly  1097 ARSRDAAETAINFYLTDMENDKTTSTLGYGQSLRKKQR-ALVVDGKTLTFILDPKSKLILPFLRL 1160

Human   772 ALSCKAVICCRVSPLQKSEVVEMVKKQVKVVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANS 836
            :..|.:|:|||.:||||:.:|::||:::.:.|||||||||||||||.|.|||||||.||:||..:
  Fly  1161 SKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMA 1225

Human   837 SDYSIAQFKYLKNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIG 901
            :|:::.:|:||:.||:.||.|.|:|:|:.|||.||||.....:..|:....|||||::.::..:.
  Fly  1226 ADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLM 1290

Human   902 LYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFP 966
            |||::||::|||.:|::::...::.:||.|.|||..:..:.:....||:..|:.|:.|:::|:..
  Fly  1291 LYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVA 1355

Human   967 LKALQYGTAFGNGKTSDYLLLGNFVYTFVVITVCLKAGL-----ETSYWTWFSHIAIWGSIALWV 1026
            |.|.         ..||   :|.:.:...:...||.|.|     |...||....::|..|:..:.
  Fly  1356 LCAY---------AESD---VGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFY 1408

Human  1027 VF-----------FGIYSSLWPAIPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIK 1080
            :|           ||:.||.|...           :.|:|.|.|:        .::|..|..|:.
  Fly  1409 LFAIVYDSVCMNCFGVRSSYWVIF-----------VCFASAVHWL--------VIMLSTVVAVLP 1454

Human  1081 RTAFKTLVDEVQELEAKSQDPGAVVLGKSLTERAQ 1115
            |....|:     .:.....|...|:| :|..||::
  Fly  1455 RLLLTTV-----RISLCPDDSTKVIL-QSKRERSR 1483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP8A1XP_011511917.1 PhoLip_ATPase_N 38..100 CDD:292826 25/72 (35%)
ATPase-Plipid 49..1093 CDD:273734 390/1253 (31%)
E1-E2_ATPase 106..>191 CDD:278548 35/87 (40%)
Cation_ATPase 486..581 CDD:289987 42/267 (16%)
HAD_like <803..853 CDD:304363 33/50 (66%)
PhoLip_ATPase_C 834..1086 CDD:292829 74/268 (28%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 21/50 (42%)
ATPase-Plipid 250..1473 CDD:273734 391/1264 (31%)
E1-E2_ATPase 302..>394 CDD:278548 36/92 (39%)
Cation_ATPase <880..965 CDD:289987 35/85 (41%)
HAD_like <1177..1240 CDD:304363 36/63 (57%)
PhoLip_ATPase_C 1223..1468 CDD:292829 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.