DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NOD1 and CG8197

Sequence 1:NP_006083.1 Gene:NOD1 HGNCID:16390 Length:953 Species:Homo sapiens
Sequence 2:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster

Alignment Length:319 Identity:67/320 (21%)
Similarity:112/320 (35%) Gaps:84/320 (26%)


Human   688 CSADCSALSFVLHHFPKRLALDL----------DNNNLNDYGVRELQPCF--------------- 727
            |..|   |..::::..:|..|.:          |...|.|: ||.|.|.:               
  Fly    63 CIRD---LRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDF-VRSLLPVWYIELRLMRFPREFFV 123

Human   728 -SRLTVLRLSVNQ-------ITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECK 784
             .||...:::|:|       :||..|::|.|.|...|.:..|.:.:..:|......:...:.:..
  Fly   124 MLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSP 188

Human   785 GLTH----------LKLGKNKITSEGGKYLA-------------------------LAVKNSKSI 814
            |:..          |.|...||:|.....|.                         ||..||| .
  Fly   189 GVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSK-F 252

Human   815 SEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNE 879
            ..:.:..|::|.:||......:....:|..|.|:...|.|.||:.:|:.|.....|::|.|..|:
  Fly   253 RRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYND 317

Human   880 LNDEVAESLAEMLKVNQTLKHLWLIQNQI---TAKGTAQLADALQSNTGITEICLNGNL 935
            :.......:...:|....|:.|.|..|..   ||....:|.||        |:.|:..|
  Fly   318 MGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDA--------EVVLHSEL 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NOD1NP_006083.1 CARD_NOD1_CARD4 21..105 CDD:260035
AAA 194..>291 CDD:214640
NACHT 197..367 CDD:283404
LRR 1 632..656
LRR_RI 676..941 CDD:238064 67/320 (21%)
LRR 2 702..725 8/33 (24%)
LRR 3 727..750 8/46 (17%)
leucine-rich repeat 730..757 CDD:275380 10/34 (29%)
LRR 4 755..778 3/23 (13%)
leucine-rich repeat 758..785 CDD:275380 2/27 (7%)
LRR 5 783..806 7/58 (12%)
leucine-rich repeat 786..813 CDD:275380 11/62 (18%)
leucine-rich repeat 814..841 CDD:275380 4/27 (15%)
LRR 6 839..862 8/23 (35%)
leucine-rich repeat 842..869 CDD:275380 9/27 (33%)
LRR 7 867..891 4/24 (17%)
leucine-rich repeat 870..897 CDD:275380 5/27 (19%)
LRR 8 895..918 7/26 (27%)
leucine-rich repeat 898..925 CDD:275380 9/30 (30%)
LRR 9 923..946 3/14 (21%)
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 9/27 (33%)
LRR_RI 137..374 CDD:238064 51/242 (21%)
leucine-rich repeat 162..189 CDD:275381 2/27 (7%)
leucine-rich repeat 202..220 CDD:275380 6/18 (33%)
leucine-rich repeat 223..251 CDD:275380 4/28 (14%)
leucine-rich repeat 252..279 CDD:275380 4/27 (15%)
leucine-rich repeat 280..307 CDD:275380 9/27 (33%)
leucine-rich repeat 308..335 CDD:275380 5/27 (19%)
leucine-rich repeat 336..357 CDD:275380 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.