DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HMG20B and TFAM

Sequence 1:NP_006330.2 Gene:HMG20B HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_732527.1 Gene:TFAM FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster

Alignment Length:215 Identity:47/216 (22%)
Similarity:87/216 (40%) Gaps:61/216 (28%)


Human    66 LPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQY 130
            ||..||.|:|.|.||:.|:|.:::..:|.:...|:.:.|...||......|:|...|.:|::|.|
  Fly    74 LPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIY 138

Human   131 MKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFTEEFLD- 194
            ::|...|..:     .||: |..:||:                              ..::.:| 
  Fly   139 VEERTKYDAT-----LTEE-QRAEIKQ------------------------------LKQDLVDA 167

Human   195 ----QNKAREAELRRLRKMNVAF------------EEQNAVLQRHTQSMSSARERL---EQELAL 240
                |.:.|..||.|.:|...||            :......:...|..::...||   |:|:.:
  Fly   168 KERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYM 232

Human   241 EERRTLALQQQLQAVRQALT 260
            :|.|     ::::..|:|::
  Fly   233 QESR-----KEMELYRKAIS 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HMG20BNP_006330.2 HMGB-UBF_HMG-box 70..135 CDD:238686 21/65 (32%)
conj_TIGR03752 195..>266 CDD:274765 17/82 (21%)
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 21/64 (33%)
HMGB-UBF_HMG-box 183..247 CDD:238686 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.