DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMG20B and HmgD

DIOPT Version :10

Sequence 1:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_726109.1 Gene:HmgD / 37481 FlyBaseID:FBgn0004362 Length:112 Species:Drosophila melanogaster


Alignment Length:101 Identity:30/101 - (29%)
Similarity:47/101 - (46%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    70 PKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQY---M 131
            ||.|::.|:.:||..||.|:..:|.:...|:.|..|..|..::  :|..:..:|.:.|..|   :
  Fly     5 PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMK--DKSEWEAKAAKAKDDYDRAV 67

Human   132 KELRAYQQSEA-------YKMCTEKIQEKKIKKEDS 160
            ||..|...|.|       .:....|...||.|||:|
  Fly    68 KEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEES 103

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity