DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HMG20B and Hmg-2

Sequence 1:NP_006330.2 Gene:HMG20B HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_611553.1 Gene:Hmg-2 FlyBaseID:FBgn0026582 Length:376 Species:Drosophila melanogaster

Alignment Length:348 Identity:87/349 (25%)
Similarity:151/349 (43%) Gaps:73/349 (21%)


Human    31 KQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKI------LPNGPKAPVTGYVRFLNERREQIR 89
            |..:|:......||.|.:..:       |.:.||:      :...||.|:.|||||:|:|||::|
  Fly    38 KPAKGKKKAKNPKGRHSDSDI-------GSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELR 95

Human    90 TRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKK 154
            ...|.....|.|:::|.||.:|....|..|::.|.::|..|.::|:.:.:.....:..|..:.||
  Fly    96 REQPQRTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEIVANELAKAKK 160

Human   155 IKKEDSS---------SGLMNTLLNGHK-----GGDCDG-------------------------- 179
            ..|.|.|         |.|........|     ..|.|.                          
  Fly   161 ATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDVPLAKVKRAQTPPPPTPPAAPVQPPP 225

Human   180 ------------FSTFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARE 232
                        ....::||:|.||::.|::.|.|||.|||.....|:|||||::|..:..:...
  Fly   226 SSVPPATPAPRPLQPGEIPIYTNEFIEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYA 290

Human   233 RLEQELA--LEERRTLALQQQLQAVRQALTASFASLPVPGTGET-PTLGTLDFYMARLHGAIERD 294
            ::..|:.  :||.:  .|:..|:|:||.|.|:...:.:|....: |::|.:|.|:..|.|.:.: 
  Fly   291 KVMGEVTELMEENQ--RLETYLRALRQKLVAALGGISMPPLEPSGPSVGNIDKYIRHLAGLVTQ- 352

Human   295 PAQHEKLIVRIKEILAQVASEHL 317
            |:  ...:::.:|.|.:|.:..|
  Fly   353 PS--NVTLIKAREALRKVDTSSL 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HMG20BNP_006330.2 HMGB-UBF_HMG-box 70..135 CDD:238686 26/65 (40%)
conj_TIGR03752 195..>266 CDD:274765 25/73 (34%)
Hmg-2NP_611553.1 HMGB-UBF_HMG-box 76..141 CDD:238686 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5648
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1458939at2759
OrthoFinder 1 1.000 FOG0002425
OrthoInspector 1 1.000 T610307
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46040
Phylome 1 0.910 0.613 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3288
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.