DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CDK4 and Cdk4

Sequence 1:NP_000066.1 Gene:CDK4 HGNCID:1773 Length:303 Species:Homo sapiens
Sequence 2:NP_001286493.1 Gene:Cdk4 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster

Alignment Length:293 Identity:139/294 (47%)
Similarity:195/294 (66%) Gaps:3/294 (1%)


Human     6 YEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN 70
            |:.:..||.|||||||:|||..:|:.||||.||:   .....|:|:||:||::||::|.|..|.|
  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRI---SLNENGVPMSTLREISLLKQLNASNHAN 87

Human    71 VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC 135
            :|:|.:||.....|.::.:.||||||:|||...:|:.|..|:...||:.|.|:.|.|:||||::.
  Fly    88 IVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHR 152

Human   136 IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV 200
            |:||||||:|:||:|.|.:|:||||||:.|..:|.||.||||||||||||||...|.:.||:||.
  Fly   153 IIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSA 217

Human   201 GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEME 265
            .||..|||.|:.||.|.||.:||.:||:|.|.|.|..||:.:|:....||.|.|:..:...|.:.
  Fly   218 ACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLC 282

Human   266 ESGAQLLLEMLTFNPHKRISAFRALQHSYLHKD 298
            :....||.:||:::.|.|.||...|:|.|..::
  Fly   283 KYADDLLNKMLSYDLHLRPSALACLEHDYFQQE 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDK4NP_000066.1 PKc_like 5..295 CDD:328722 139/289 (48%)
Required for binding D-type cyclins 50..56 4/6 (67%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 139/289 (48%)
S_TKc 26..312 CDD:214567 139/289 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0594
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2860
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D419040at33208
OrthoFinder 1 1.000 FOG0002655
OrthoInspector 1 1.000 T609204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5120
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.