DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG34444

DIOPT Version :10

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster


Alignment Length:86 Identity:27/86 - (31%)
Similarity:39/86 - (45%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GFDESCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGENVYREV---YEHAEQQGF 188
            |..:|||||.:||...:...|: |.:|.:|        :|..|:|..:.|.|:   |..||..|.
  Fly   210 GAGDSCLLRLICEANSYQLGDL-NGVLGSL--------IHVMFSPSSSRYEELPKRYYIAELDGR 265

  Fly   189 LGMDCGHLYSNCPVDFLSGIS 209
            .| :||.....|....|..|:
  Fly   266 NG-NCGGYRVQCEHSVLDMIT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 25/81 (31%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:462285 24/75 (32%)

Return to query results.
Submit another query.