DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG34429

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster

Alignment Length:206 Identity:52/207 (25%)
Similarity:88/207 (43%) Gaps:30/207 (14%)


  Fly    26 LPLLFPASSV--YQITSSLSVPVVIPDRK---LFWDWGLQMNYALP--------------AEPSS 71
            |||::|.::.  .|:.:...:|.  .|.|   :...:.|:..|.||              :|...
  Fly    42 LPLIYPRANPTRLQMIAGFGIPA--EDLKVESVITGYVLKAQYYLPYSAKQLRTKDVHEISESRL 104

  Fly    72 FYAATIWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGFD-ESCLLR 135
            ...|||: |:..:..:::|..: ...|.|.:..:....::   :||:...:.|:...: ..|:|:
  Fly   105 LQNATIF-DKVMQMSEQKLGFD-PDILQEDLQALGSYRWS---VYEAFTALAIRMKLNGRVCVLK 164

  Fly   136 SVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNC 200
            |:||.|..||.| .|.:|..:|...||||  .:..|........|..||:.|..|.||..:|..|
  Fly   165 SICESAAAPFDD-RNGLLGEVLHILLTPS--SSVDPLSEHSDNDYLQAERLGAAGGDCDQVYPRC 226

  Fly   201 PVDFLSGISSL 211
            |...|...|.:
  Fly   227 PKSLLEHFSDV 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 31/100 (31%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48041
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.