DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG34443

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster

Alignment Length:235 Identity:62/236 (26%)
Similarity:97/236 (41%) Gaps:48/236 (20%)


  Fly     7 HFMGALLSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSS 71
            :|:|.:..|...|.  |....:.|.|||.:.|.::::||:.:|.|.:|..:..:.||.|||....
  Fly     6 YFLGLVFLLTVYLD--LTNSFVAFTASSTHGIFAAIAVPLELPHRNVFVSYNFEANYNLPANWEK 68

  Fly    72 FYAATIWP----------DEFSRRRKRQL-----------WNETAKYLPEGVSTMHPSD------ 109
            :   ||:.          ||......|:|           .||......|.::.:.|.:      
  Fly    69 W---TIFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSL 130

  Fly   110 FTAGELYESLENMLIQYGF-DESCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGE 173
            .|...:|....:.|.:.|| .||||||.:||.:.... |..|.:|.:|        :|..|:|..
  Fly   131 LTRSNIYRIFVDKLKRSGFRGESCLLRLICETSAAQL-DEFNGVLGSL--------MHVLFSPSS 186

  Fly   174 NVYREV---YEHAEQQGFLGMDCGHLYS-NCPVDFLSGIS 209
            :...::   |..||..|:.| .| |:|. .|....|..||
  Fly   187 SESEDLPLRYYQAEHDGWNG-HC-HVYEPGCGESILELIS 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 31/110 (28%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48562
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.