DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG34443

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:235 Identity:62/235 - (26%)
Similarity:97/235 - (41%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HFMGALLSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSS 71
            :|:|.:..|...|.  |....:.|.|||.:.|.::::||:.:|.|.:|..:..:.||.|||....
  Fly     6 YFLGLVFLLTVYLD--LTNSFVAFTASSTHGIFAAIAVPLELPHRNVFVSYNFEANYNLPANWEK 68

  Fly    72 FYAATIWP----------DEFSRRRKRQL-----------WNETAKYLPEGVSTMHPSD------ 109
            :   ||:.          ||......|:|           .||......|.::.:.|.:      
  Fly    69 W---TIFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSL 130

  Fly   110 FTAGELYESLENMLIQYGF-DESCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGE 173
            .|...:|....:.|.:.|| .||||||.:||.:.... |..|.:|.:|        :|..|:|..
  Fly   131 LTRSNIYRIFVDKLKRSGFRGESCLLRLICETSAAQL-DEFNGVLGSL--------MHVLFSPSS 186

  Fly   174 NVYREV---YEHAEQQGFLGMDCGHLYS-NCPVDFLSGIS 209
            :...::   |..||..|:.| .| |:|. .|....|..||
  Fly   187 SESEDLPLRYYQAEHDGWNG-HC-HVYEPGCGESILELIS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 30/109 (28%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.