DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG34184

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:212 Identity:56/212 - (26%)
Similarity:93/212 - (43%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPA---------- 67
            ||.:..|:.|..|..||:..:|.:.|..::|||:.:.:|.:|..:..:.||..|.          
  Fly     6 LSCFVFLKLIFVESTLLYQTNSEFGIFMAISVPLTLKNRNVFLSYNYEFNYYQPEHVYKYPPILM 70

  Fly    68 ----EPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGF 128
                |.|.....|...|:.|..|..:..::.:......:..|..::|     |..|::.|.:.|:
  Fly    71 GDNWEDSYLTYNTTGGDDSSSSRSFRSVDDNSSTQKRTLPIMSRTNF-----YIMLKDKLERSGY 130

  Fly   129 D-ESCLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMD 192
            . ||||||.:||.......:| |.:|.:::....|||    .:..||:.::.|: ||..|....|
  Fly   131 PAESCLLRLICETNSSTLGEV-NGLLGSIVHILFTPS----SSNDENLDKDYYQ-AEWDGLRHGD 189

  Fly   193 CGHLYSNCPVDFLSGIS 209
            |....|.|..:.|..||
  Fly   190 CSFYASQCEENVLDLIS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 29/99 (29%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.