DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG42812

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster

Alignment Length:194 Identity:88/195 (45%)
Similarity:122/195 (63%) Gaps:9/195 (5%)


  Fly    28 LLFPASSVYQITSSLSVPV--VIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQL 90
            ||:||||...:|.|:|.|:  :.|:|::..||...::|..|...:.||:..|||...:.:.||::
  Fly    22 LLWPASSNLGLTLSVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSIPIWPGFANYKAKREV 86

  Fly    91 -------WNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGFDESCLLRSVCELARHPFKDV 148
                   .|...||..:..:.|||.||:|||||..||:.|..|||.|:||||||||||:|||.|.
  Fly    87 PQLEMTDENFYTKYGHDNGNGMHPKDFSAGELYAFLEDTLTGYGFHETCLLRSVCELAQHPFDDS 151

  Fly   149 ENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFLSGISSLL 212
            ..::|:.::||.|:||.||.|...|:|||:.||.|||.||||.||..|||:|..|.|..:|.::
  Fly   152 HQHLLSDIVTFVLSPSQHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLYSHCKHDILQLMSQVI 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 59/99 (60%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 59/100 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139738744
eggNOG 1 0.900 E1_2C43J
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.