DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG13616

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster

Alignment Length:239 Identity:55/240 (23%)
Similarity:92/240 (38%) Gaps:69/240 (29%)


  Fly     4 TGVHFMGALLSLWSILRPILAELP----------------------LLFPASSVYQITSSLSVPV 46
            || ||  :||:|..:|..:.:::.                      |.||..|.......:::.:
  Fly     6 TG-HF--SLLALCLLLHEVQSQVMSMSSAANRTGEVTKVLRRHKRYLAFPEGSSVSGAVCMTIGM 67

  Fly    47 V-IPD-RKLFW--DWGLQMNYALP-----AEPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEGV 102
            : .|| ..|.|  :||:.  |.||     .:.:....||:..|...||.:|              
  Fly    68 IGNPDVDYLSWAVNWGVA--YDLPNHQWVIQHAHGLNATLAKDTIKRRSRR-------------- 116

  Fly   103 STMHPSDFTAGELYESLENMLIQYGFD-ESCLLRSVCELARHPFKDVE-NNMLTALL--TFTLTP 163
                       ..|:.::::....||: .||:.|::||.|:.....|| .|||..|:  .|:|.|
  Fly   117 -----------AFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFSLPP 170

  Fly   164 SLHEAFAP-GENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFLS 206
            |...|..| ..:.|..:|..:::.   ..||..:|..|....|:
  Fly   171 SPVAAHEPQAHHQYDRIYRRSKRS---SRDCHEIYPGCQFSLLA 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 28/104 (27%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49077
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.