DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG17780

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster

Alignment Length:99 Identity:24/100 (24%)
Similarity:35/100 (35%) Gaps:38/100 (38%)


  Fly    55 WDWGLQMNYALPA--EPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELYE 117
            :.:|.:.||..|:  |.....|.      |.|..||                         :|:.
  Fly   108 YGYGFRANYPFPSIEEQKKDNAV------FFRLFKR-------------------------DLFS 141

  Fly   118 SLENMLIQYGFD-ESCLLRSVCELARHPFKDVEN 150
            .||..|..:||| .:|:|:|.|.    ...||:|
  Fly   142 KLETALDGHGFDGRACMLKSFCT----AINDVDN 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 14/46 (30%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 16/66 (24%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.