powered by:
Protein Alignment CG42811 and CG17780
DIOPT Version :9
| Sequence 1: | NP_001189279.1 |
Gene: | CG42811 / 10178941 |
FlyBaseID: | FBgn0261993 |
Length: | 213 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_732995.1 |
Gene: | CG17780 / 42914 |
FlyBaseID: | FBgn0039197 |
Length: | 345 |
Species: | Drosophila melanogaster |
| Alignment Length: | 99 |
Identity: | 24/99 - (24%) |
| Similarity: | 35/99 - (35%) |
Gaps: | 38/99 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 WDWGLQMNYALPA--EPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELYE 117
:.:|.:.||..|: |.....|. |.|..|| :|:.
Fly 108 YGYGFRANYPFPSIEEQKKDNAV------FFRLFKR-------------------------DLFS 141
Fly 118 SLENMLIQYGFD-ESCLLRSVCELARHPFKDVEN 150
.||..|..:||| .:|:|:|.|. ...||:|
Fly 142 KLETALDGHGFDGRACMLKSFCT----AINDVDN 171
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG42811 | NP_001189279.1 |
DM4_12 |
107..206 |
CDD:214785 |
14/45 (31%) |
| CG17780 | NP_732995.1 |
DM4_12 |
136..>188 |
CDD:285126 |
16/65 (25%) |
| DM4_12 |
253..338 |
CDD:214785 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR21398 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.