DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG17780

DIOPT Version :10

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:35/99 - (35%) Gaps:38/99 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WDWGLQMNYALPA--EPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELYE 117
            :.:|.:.||..|:  |.....|.      |.|..||                         :|:.
  Fly   108 YGYGFRANYPFPSIEEQKKDNAV------FFRLFKR-------------------------DLFS 141

  Fly   118 SLENMLIQYGFD-ESCLLRSVCELARHPFKDVEN 150
            .||..|..:||| .:|:|:|.|.    ...||:|
  Fly   142 KLETALDGHGFDGRACMLKSFCT----AINDVDN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 14/45 (31%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285 16/65 (25%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.