DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG13613

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster

Alignment Length:216 Identity:111/217 (51%)
Similarity:139/217 (64%) Gaps:14/217 (6%)


  Fly     1 MYITGVHFMGAL----LSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDR-KLFWDWGLQ 60
            ||.:.:..:|.|    |.|.:::|||..  .||||.|:|.|:|||:|:|..:..| |:|.|.|.|
  Fly     1 MYRSKLQNVGDLGQVSLLLITLIRPIYG--LLLFPTSTVLQLTSSISIPADLNTRTKVFMDMGFQ 63

  Fly    61 MNYALPAEPSSFYAATIWPDEFSRRRKRQLWN----ETAKYLPEGVSTMHPSDFTAGELYESLEN 121
            |||.||...|:||.||||.||.|||:||||.:    ...:|..||  .|||:|||||:||:.:||
  Fly    64 MNYNLPPTVSAFYNATIWADELSRRQKRQLDHSLDANLQQYDLEG--GMHPADFTAGQLYKGIEN 126

  Fly   122 MLIQYGFDESCLLRSVCELARHPF-KDVENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQ 185
            ||..|||..|||||||||||.||| :|....|:|.::||.||||.||.||..|..||:.||.|||
  Fly   127 MLETYGFHRSCLLRSVCELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQ 191

  Fly   186 QGFLGMDCGHLYSNCPVDFLS 206
            .||||..|...|.:|..|.::
  Fly   192 IGFLGGQCHLSYPSCQADIIN 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 58/100 (58%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139738725
eggNOG 1 0.900 E1_2C43J
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.