DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG14115

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster

Alignment Length:237 Identity:60/238 (25%)
Similarity:97/238 (41%) Gaps:52/238 (22%)


  Fly     2 YITGVHFMGALLSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALP 66
            |:.||..:|  ||        ||...|:||....:.:.:::::|:.:..:.::..:..:.|||||
  Fly     9 YLGGVFVLG--LS--------LAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAFNFESNYALP 63

  Fly    67 AEPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEG-------------------------VSTMH 106
            :..|    ...|.|.         |:....||..|                         .|...
  Fly    64 SNDS----YNQWIDR---------WDLDDHYLGVGGNVTPINARQDGGDFSQDEDNEVRRRSVGS 115

  Fly   107 PSDFTAGELYESLENMLIQYGFDES-CLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFA 170
            |..|...:.|.|:.|.|..|||:.| ||||::||::..|..| :|.:|.:|......|:...|..
  Fly   116 PPPFRRHDFYRSIINFLTHYGFNGSACLLRTICEVSESPLDD-QNGLLGSLFQILFMPTTSAAEQ 179

  Fly   171 PGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFLSGISSLL 212
            ..::| .|:|: |...|..|..|....::|....|..||.:|
  Fly   180 ELQHV-DELYK-ASDAGTHGPGCSEYVAHCGHSALDLISIVL 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 32/100 (32%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48579
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.