DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42811 and CG13869

DIOPT Version :9

Sequence 1:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:185 Identity:41/185 - (22%)
Similarity:70/185 - (37%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLFPASSVYQITSSLSVPVVIPDRKLFWD---WGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQ 89
            |::....|.:..|..:.|....::|. |.   |.:..:|......:..|...:|  :.||..|..
  Fly    37 LIYQNGGVIKFVSGCAFPAPFMEKKA-WRQLVWLMNFHYQFNEPQTPIYWWKLW--DGSRNLKGP 98

  Fly    90 LWNETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGFDESCLLRSVCELARHPFKDVENNMLT 154
            |.......:|..:....| .....:..|:..|.|.|.|  .:||.|.:||..:..    |::.|.
  Fly    99 LTQPAPPSVPARLLVDEP-QLLLFKFAEAYMNQLGQNG--SACLDRLICENGQVD----EHSGLY 156

  Fly   155 ALLTFTLTPSLHEAFAPGENV---YREVYEHAEQQGFLGMDCGHLY---SNCPVD 203
            |.|       ||....|.:.:   |.:.|    :.|..|:||.:.:   .:|.:|
  Fly   157 AQL-------LHRLLRPHQTLDVRYLDAY----RMGRHGVDCRNAFPEAHHCILD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 26/103 (25%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.