powered by:
                   
 
    
    
             
          
            Protein Alignment CG42811 and CG33262
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001189279.1 | Gene: | CG42811 / 10178941 | FlyBaseID: | FBgn0261993 | Length: | 213 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_996071.2 | Gene: | CG33262 / 2768975 | FlyBaseID: | FBgn0053262 | Length: | 208 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 188 | Identity: | 46/188 - (24%) | 
          
            | Similarity: | 74/188 -  (39%) | Gaps: | 55/188 - (29%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    28 LLFP--ASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQL 90|:||  |.:.:|..:.:.:|..:....|...:.|:..|.||      |.||::       |:..|
 Fly    34 LIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLP------YNATVY-------RQNPL 85
 
 
  Fly    91 WNETAKYLPEGVST-------MHPSDFTAGELYESLENMLIQYGFD-ESCLLRSVCELARHPFKD 147:.|   |.|..:..       |.|:|. ..:||:.:|:||..||.: .:|||.::||
 Fly    86 FPE---YKPNTIDAQDQRKLFMKPTDL-RWQLYQFIEHMLNGYGLNGHACLLEAICE-------- 138
 
 
  Fly   148 VENNMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFL 205.||:..|....|....||...:|...:..|                   ||..:||:
 Fly   139 -ANNIKFAKDFSTAGEMLHLLLSPSSTLNSE-------------------SNRALDFI 176
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | CG42811 | NP_001189279.1 | DM4_12 | 107..206 | CDD:214785 | 26/100 (26%) | 
          
            | CG33262 | NP_996071.2 | DM4_12 | 110..192 | CDD:285126 | 24/95 (25%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR21398 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.