DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42811 and CG33342

Sequence 1:NP_001189279.1 Gene:CG42811 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster

Alignment Length:184 Identity:51/185 (28%)
Similarity:78/185 (42%) Gaps:32/185 (17%)


  Fly    29 LFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALPAEPSSFYAATIWPDEFSRRRKRQLWN- 92
            :|......:|.:.|:.|:...| .:...||. :||.....||.  ....|         ...|| 
  Fly    48 IFNGQGTNKIVAGLAFPIKQAD-TVQSVWGF-VNYQAQYVPSP--VPIYW---------WSFWNT 99

  Fly    93 ----ETAKYLPEGVSTMHPSDFTAGELYESLENMLIQYGFDE---SCLLRSVCELARHPFKDVEN 150
                .||:...:|:.:....|.|...||:.:|..|.:.| |.   :|||:.:||:::.||  :.|
  Fly   100 STFLSTAREWRKGIRSRVFQDETRVWLYDVVETGLERLG-DRNAGACLLKCICEISQRPF--MHN 161

  Fly   151 NMLTALLTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDF 204
            ::...:|...|.|||       :|| .|.|.||...|..|.:|...||:|...|
  Fly   162 SIFGEILNAVLVPSL-------DNV-PEKYLHARNAGKAGANCRKTYSDCSKAF 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 34/102 (33%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49018
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.