DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZNF263 and CG6654

Sequence 1:NP_005732.2 Gene:ZNF263 HGNCID:13056 Length:683 Species:Homo sapiens
Sequence 2:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster

Alignment Length:667 Identity:173/668 (26%)
Similarity:260/668 (39%) Gaps:161/668 (24%)


Human    59 LSRLQEL--CHGW---LRPEMRTKEQILELLVLEQFLTILPQEIQSRV----------QELHPES 108
            ||.|.|:  |:.:   .....||..|:|.        ..||:|..|:|          |.:...|
  Fly    53 LSCLSEISNCYTFKIKCENSSRTLRQLLP--------NALPEEPDSKVSISCPVATTDQAVQTTS 109

Human   109 GE----------EAVTLVEDMQRELGRLRQQVT----NHGRGTEVLLEEPLPLETARESPSFKLE 159
            .|          :||| ..|.::....::..::    ..|.|.  :.:..||.|...::.|..|:
  Fly   110 WEPDRCTASVQTDAVT-TTDAEQNTSLIKSTISVDLDYEGEGE--VFDYELPDEPVEKTTSLILQ 171

Human   160 PMETERSPGPRLQELLGPSPQRDPQAVKERALSAPWLSLFPPEGNMEDKE---MTGPQLPESLED 221
            .....:.....:........:.|...::::..... |::|  ||...:.|   :|.||:......
  Fly   172 VQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECN-LAIF--EGVDNEAEIITVTAPQVTTRKSA 233

Human   222 VAMYISQEEWGHQDP--SK---RALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSV 281
            ..:...||...||.|  ||   |.|.::.|.:|.:.. |....:..|:||.|..           
  Fly   234 AKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRT-SRRRGVVKQDVPATPP----------- 286

Human   282 QSCKEGLSPRGPAPGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWA 346
                   |...|:|.:.:                    |..|.:...|.:..:..|...|     
  Fly   287 -------SDAEPSPKQHR--------------------LGTQRKLSAPRAGTVNGPSTTS----- 319

Human   347 PPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMG--- 408
                        ||::..||         |.| |..|...|:...:|:.|:|    ::.|:.   
  Fly   320 ------------GAATTPEL---------KYH-CDRCNAGFAVEKSLMIHRR----QKGCINRNY 358

Human   409 --VDCTEIFGGNPRFLSLHRAHLGEEAHKCLECG-KCFSQNTHLTRHQ-RTHTGEKPYQCNICGK 469
              .:|.::| .:|..|:.|:|..|  ||.|.||| :|.|:.. |::|. :.|......|||||.|
  Fly   359 KCNECEKVF-VSPDHLAEHQASHG--AHNCPECGIRCDSKEA-LSKHMVQGHKRNLRNQCNICQK 419

Human   470 CFSCNSNLHRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLV 534
            .|:..|.|..|.|.||||||:.|..||:.|..::||.:|:..|:..:.:||..|..||...:.|.
  Fly   420 VFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELT 484

Human   535 IHERTHERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTG 599
            .|.|||..:                             |.|||..|...|.....|.:|:|.|||
  Fly   485 SHARTHTGD-----------------------------KPFECEVCLARFTTSCSLAKHKRKHTG 520

Human   600 EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSEC 664
            |:||.|.||...|:..:.|..|:|.||||:||.|..|..:|:...:...|.|||.|||.|.|..|
  Fly   521 ERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVC 585

Human   665 GESFSRSSRLMSHQRTH 681
            .|.|.....:.||...|
  Fly   586 NEEFKSMPEMRSHLAGH 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZNF263NP_005732.2 SCAN 38..149 CDD:128708 26/119 (22%)
Dendrin <128..>347 CDD:317849 40/231 (17%)
KRAB 218..277 CDD:214630 16/64 (25%)
C2H2 Zn finger 380..400 CDD:275368 6/20 (30%)
zf-C2H2 380..400 CDD:306579 6/20 (30%)
COG5048 <434..649 CDD:227381 76/217 (35%)
C2H2 Zn finger 436..456 CDD:275368 8/22 (36%)
C2H2 Zn finger 464..484 CDD:275368 10/20 (50%)
C2H2 Zn finger 492..512 CDD:275368 7/20 (35%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 577..597 CDD:275368 6/20 (30%)
C2H2 Zn finger 605..625 CDD:275368 7/20 (35%)
COG5048 629..>682 CDD:227381 20/54 (37%)
C2H2 Zn finger 633..653 CDD:275368 6/20 (30%)
C2H2 Zn finger 661..681 CDD:275368 6/20 (30%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 8/26 (31%)
C2H2 Zn finger 331..354 CDD:275368 7/27 (26%)
COG5048 <357..570 CDD:227381 84/246 (34%)
C2H2 Zn finger 360..380 CDD:275368 6/21 (29%)
C2H2 Zn finger 385..406 CDD:275370 8/22 (36%)
C2H2 Zn finger 414..434 CDD:275368 10/20 (50%)
zf-H2C2_2 427..451 CDD:290200 13/24 (54%)
C2H2 Zn finger 442..490 CDD:275368 17/48 (35%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 11/54 (20%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 13/24 (54%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 12/24 (50%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.