DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNM1L and shi

DIOPT Version :8

Sequence 1:NP_001265393.1 Gene:DNM1L / 10059 HGNCID:2973 Length:749 Species:Homo sapiens
Sequence 2:NP_001259588.1 Gene:shi / 45928 FlyBaseID:FBgn0003392 Length:896 Species:Drosophila melanogaster

Alignment Length:807 Identity:303/808 (38%)
Similarity:447/808 (55%) Gaps:116/808 (14%)


Human     1 MEALIPVINKLQDVFNTVGADI-IQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLI 64
            |::||.::|||||.|.::|..: :.||||.|||.||:|||||||:.||:|.||||:|||||||||
  Fly     1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLI 65

Human    65 LQLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETE 129
            |||::                           ||  .|:|:|||.|.|.::.|||||:|||:||:
  Fly    66 LQLIN---------------------------GV--TEYGEFLHIKGKKFSSFDEIRKEIEDETD 101

Human   130 RISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSII 194
            |::|:|||:|..||:|:::||:|:||||:||||:|||.:||||.|||.||:::|.:||.....:|
  Fly   102 RVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLI 166

Human   195 LAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVN 259
            ||||.||||:|.|:|||:::||||.|.||:.|||||||||.||||.|:|..:::|::.|.|||||
  Fly   167 LAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVN 231

Human   260 RSQLDINNKKSVTDSIRDEYAFL--QKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI- 321
            |||.||..:|.:..::..|..|.  ...|..:|:|.||.||.|.||:.|.:||||.||.|:.:: 
  Fly   232 RSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQ 296

Human   322 -NVLAAQYQSLLNSYGEPVDD--KSATLLQLITKFATEYCNTIEGT-AKYIETSELCGGARICYI 382
             .:|..:.:.....:.:|.|.  |:..:||:|.:..:::..||||: :..:.|:||.|||:|..|
  Fly   297 KQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRI 361

Human   383 FHETFGRTLESVDPLGGLNTI--DILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCV 445
            |||..  ..|.|........:  :|..||||..|.|..||.|:::||.:|||||..|:||.::||
  Fly   362 FHERL--RFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCV 424

Human   446 ELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTK 510
            :||.:|:..:::.|    |.::.|:|:|.:....::|..:|:|.....|.:..|:..||||:||.
  Fly   425 DLVVQELSVVVRMC----TAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTN 485

Human   511 HPDFADACGLMNNNIEEQRRNRL-ARELPSAVSRD-----------KSSKVPSA-------LAPA 556
            |.||   .|..|...:.:..|:. .|:|.:.|.|.           |..|:..:       .:|:
  Fly   486 HEDF---IGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKDIKLGRSGPLNVRFFSPS 547

Human   557 SQEPSP---AASAEA------------------DGKLIQD--------SRRETKNVASGGGGVGD 592
            :....|   ..::|:                  ||..::|        |||.|..:.|..|    
  Fly   548 TGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDG---- 608

Human   593 GVQEPTTGNWRGMLKTSKAEELLAEE----KSKPIPIMPAS--PQKGHAVNLLDVPVPVARKLSA 651
                      |.:.|..|..||..|.    :|.....:.|.  |:|.......|...........
  Fly   609 ----------RNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDP 663

Human   652 REQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTES 716
            :.:|..|.|..|:.||..||.|..:|.||||:|..::|:.||.:..||:..||.|.....::.||
  Fly   664 QLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEES 728

Human   717 EDMAQRRKEAADMLKALQGASQIIAEI 743
            .:.|.||:|...|.:|.:.|.|||.::
  Fly   729 AESATRREEMLRMYRACKDALQIIGDV 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNM1LNP_001265393.1 DLP_1 23..315 CDD:206738 156/294 (53%)
G1 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 32..39 5/7 (71%)
G2 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 58..60 2/2 (100%)
G3 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 159..162 3/3 (100%)
G4 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 228..231 3/3 (100%)
Dynamin_M 239..522 CDD:307257 105/292 (36%)
G5 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 258..261 3/3 (100%)
Middle domain. {ECO:0000269|PubMed:15208300} 357..502 52/148 (35%)
Interaction with GSK3B. {ECO:0000269|PubMed:9731200} 461..698 68/291 (23%)
B domain. {ECO:0000269|PubMed:15208300} 515..582 19/115 (17%)
GED 655..743 CDD:308047 35/88 (40%)
Important for homodimerization. {ECO:0000269|PubMed:23584531} 667..681 7/14 (50%)
shiNP_001259588.1 DYNc 1..240 CDD:197491 147/268 (55%)
CrfC 73..>498 CDD:223771 191/434 (44%)
Dynamin_M 212..498 CDD:279383 105/295 (36%)
PH_dynamin 512..644 CDD:269958 25/146 (17%)
PH 552..638 CDD:278594 18/100 (18%)
GED 664..755 CDD:128597 35/91 (38%)
DUF4527 <758..819 CDD:291689
Drf_FH1 <761..>846 CDD:283903
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141880at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126660
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.