DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNM1L and fzo

DIOPT Version :8

Sequence 1:NP_001265393.1 Gene:DNM1L / 10059 HGNCID:2973 Length:749 Species:Homo sapiens
Sequence 2:NP_732840.1 Gene:fzo / 42745 FlyBaseID:FBgn0011596 Length:718 Species:Drosophila melanogaster

Alignment Length:574 Identity:85/575 (15%)
Similarity:177/575 (31%) Gaps:245/575 (43%)


Human     1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLIL 65
            :|.|....::::.:...:..|.:   ::...|..|:|||:|:.:|:...:||...|         
  Fly    65 LEHLCAFSSRVEAIAKVLSRDRM---KVAFFGRTSNGKSAVINALLHEKILPSAMG--------- 117

Human    66 QLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETER 130
                                                      ||.    :.|.:::....||||.
  Fly   118 ------------------------------------------HTT----SCFCQVQANGSNETEH 136

Human   131 ISGNNKGVSPEPIHLKI---------FSPNVV--------------------NLTLVDLPGMTKV 166
            :.     |..|..|:::         .||..:                    ::.|:|.||:   
  Fly   137 VK-----VEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGV--- 193

Human   167 PVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLD 231
                   |:..|:.:.:..:..:.:..||.:.|.:|      ..::.|:...|      |.:|| 
  Fly   194 -------DVTAQLDDCLDSYCMDADVFILVLNAEST------VSRVERQFFKD------VASKL- 238

Human   232 LMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDI-NNKKSVTDSIRDEYAFLQKKYPSLANRNGT 295
                                       :|..|.| ||:.....|:.          |.:..:...
  Fly   239 ---------------------------SRPNLFILNNRWDKASSLE----------PEMEQKVKD 266

Human   296 KYLARTLNRLL---------------MHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSAT 345
            :::.|.:|.|:               ::|:        :.:..|..:...:.|..|:     :..
  Fly   267 QHMERCVNLLVDELGVYSTAQEAWERIYHV--------SALEALHIRNGQITNPSGQ-----TQQ 318

Human   346 LLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIR 410
            ..|...:|..::.|.:..:|  ::|.               ||..|.|...:  ||.:       
  Fly   319 RYQEFLRFENDFSNCLAVSA--LKTK---------------FGPHLLSAQKI--LNQL------- 357

Human   411 NATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVEL---------VHEEMQRIIQHCSNYSTQE 466
                 :..|..|      .:::..:.::|...|...|         :.:|.:..:|:|       
  Fly   358 -----KSTLICP------FIEKVSRLIDENKERRANLNAEIEDWLILMQEDREALQYC------- 404

Human   467 LLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLV-AIELAYINTKHPDFADACG 519
               |.:|.:....|..|:|       |:.:..|: :..|::....||:|....|
  Fly   405 ---FEELTEMTQRVGRCVL-------NDQIKTLIPSSVLSFSQPFHPEFPAQIG 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNM1LNP_001265393.1 DLP_1 23..315 CDD:206738 48/337 (14%)
G1 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 32..39 4/7 (57%)
G2 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 58..60 0/2 (0%)
G3 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 159..162 2/3 (67%)
G4 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 228..231 2/3 (67%)
Dynamin_M 239..522 CDD:307257 45/308 (15%)
G5 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 258..261 1/3 (33%)
Middle domain. {ECO:0000269|PubMed:15208300} 357..502 24/155 (15%)
Interaction with GSK3B. {ECO:0000269|PubMed:9731200} 461..698 12/61 (20%)
B domain. {ECO:0000269|PubMed:15208300} 515..582 1/6 (17%)
GED 655..743 CDD:308047
Important for homodimerization. {ECO:0000269|PubMed:23584531} 667..681
fzoNP_732840.1 DLP_2 87..334 CDD:206739 54/383 (14%)
Fzo_mitofusin 572..716 CDD:282633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.