DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNM1L and Drp1

DIOPT Version :8

Sequence 1:NP_001265393.1 Gene:DNM1L / 10059 HGNCID:2973 Length:749 Species:Homo sapiens
Sequence 2:NP_001259946.1 Gene:Drp1 / 33445 FlyBaseID:FBgn0026479 Length:735 Species:Drosophila melanogaster

Alignment Length:772 Identity:490/773 (63%)
Similarity:589/773 (76%) Gaps:60/773 (8%)


Human     1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLIL 65
            |||||||||||||||||||:|.||||||||:|:||||||||:||:|||..|||||||||||||:|
  Fly     1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVL 65

Human    66 QLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETER 130
            ||:: |..|.|:....||..:            .|||||:||||| |.:|||||||:||||||||
  Fly    66 QLIY-SPLDDRENRSAENGTS------------NAEEWGRFLHTK-KCFTDFDEIRKEIENETER 116

Human   131 ISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIIL 195
            .:|:|||:.||||:|||||.:|||||||||||:|||||||||:|||.||:||:|::|.|||||||
  Fly   117 AAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIIL 181

Human   196 AVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNR 260
            ||||||||||||||||::::|||||||||||:||||||||||||:|:|.|||||||||||||:||
  Fly   182 AVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNR 246

Human   261 SQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLA 325
            ||.||.::|.:.|.::||.||||:|||:||.||||.|||:|||||||||||||||:||||:|::|
  Fly   247 SQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIMA 311

Human   326 AQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRT 390
            .|:|||||||||.|.|||.||||:||||::.||.||||||:.|||:|||||||:.||||||||||
  Fly   312 TQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRT 376

Human   391 LESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRI 455
            |:|:.||.||:.:|||||||||||||||||||||||||||||||:||||||||||||:|||||||
  Fly   377 LDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELIHEEMQRI 441

Human   456 IQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGL 520
            :|||.|...||:|||||||:.||:|||.|||:|||.||.||.|:|||||||||||||||.....|
  Fly   442 VQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAAL 506

Human   521 MNN------------NIEEQRRNRLAREL-PSAVSRDKSSKVPSALAPASQEPSPAASAEADGKL 572
            :.:            |:.::|.|.....: |...|....|:.|.    ..|.|.|.:|.:...::
  Fly   507 VPSLLKTDSDPYSQINLGQRRANTPRNHMSPQISSHSAGSQQPQ----QQQPPQPNSSQQQYSQV 567

Human   573 IQD---SRRETKNVASGGGGVGDGVQEPTTGNWRGML---KTSKAEELLAEEKSKPIPIMPASPQ 631
            .:.   :...|.::||               .|...:   ..::.:.:.....:.|:.....||.
  Fly   568 HEQNHVAENSTPSMAS---------------TWLSNILPPAPTRPDSIENSTNNTPVHNNIVSPV 617

Human   632 KGHAVNLL-DVPV---PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVK 692
            |  .|||| |||.   |  |:|:.:||:||:|||.||||||.||||:||||||||:||||||:||
  Fly   618 K--PVNLLPDVPANHNP--RRLTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVK 678

Human   693 DTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW 749
            |.||||||..||||...:.||.||:.:|.||||||||||||..|:.||:||||||:|
  Fly   679 DNLQSELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETHMW 735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNM1LNP_001265393.1 DLP_1 23..315 CDD:206738 212/292 (73%)
G1 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 32..39 6/7 (86%)
G2 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 58..60 2/2 (100%)
G3 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 159..162 3/3 (100%)
G4 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 228..231 3/3 (100%)
Dynamin_M 239..522 CDD:307257 214/283 (76%)
G5 motif. {ECO:0000255|PROSITE-ProRule:PRU01055} 258..261 2/3 (67%)
Middle domain. {ECO:0000269|PubMed:15208300} 357..502 115/145 (79%)
Interaction with GSK3B. {ECO:0000269|PubMed:9731200} 461..698 108/260 (42%)
B domain. {ECO:0000269|PubMed:15208300} 515..582 13/83 (16%)
GED 655..743 CDD:308047 63/88 (72%)
Important for homodimerization. {ECO:0000269|PubMed:23584531} 667..681 12/14 (86%)
Drp1NP_001259946.1 DLP_1 23..301 CDD:206738 212/292 (73%)
CrfC 88..728 CDD:223771 419/664 (63%)
Dynamin_M 226..507 CDD:279383 213/281 (76%)
GED 643..729 CDD:280391 62/86 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0699
Hieranoid 1 1.000
Homologene 1 1.000 H6384
Inparanoid 1 1.050 917 1.000 Inparanoid score I355
Isobase 1 0.950 0 Normalized mean entropy S470
OMA 1 1.010
OrthoDB 1 1.010 D141880at33208
OrthoFinder 1 1.000 FOG0003119
OrthoInspector 1 1.000 T1074654
orthoMCL 1 0.900 OOG5_126660
Panther 1 1.100 LDO PTHR11566
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2093
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.