DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAJB6 and CG5001

Sequence 1:XP_005249572.1 Gene:DNAJB6 HGNCID:14888 Length:334 Species:Homo sapiens
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:316 Identity:100/317 (32%)
Similarity:139/317 (44%) Gaps:86/317 (27%)


Human     3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67
            |||::||:.:.|:.::||||||||||::|||||  ....||.|||:||||||||||..||::|||
  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66

Human    68 YGKEGLNGGG--GGGSHFDSPFEFGFTFR---NPDDVFREFFGGRDPFS--FDFFEDPFE----- 120
            ||::||..||  .||     |....||::   :|...|.:|||..:||:  ||..::.|:     
  Fly    67 YGEDGLKSGGTRNGG-----PSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFD 126

Human   121 -----DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGF---------------TSFG 165
                 |||.:..|..||| .|.||.|.     |||.|...:..|.|               .:..
  Fly   127 LDTEPDFFSSPFGGIGSR-HGLGSGFR-----PSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLE 185

Human   166 SLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTIN 230
            .:.||                          .|...||:.:.:..:|..|.|.      |.|.|:
  Fly   186 EIYHG--------------------------CVKKMKISRRIVQADGSSRKEE------KFLAIS 218

Human   231 GVADDDALAEERMRRGQNALPAQPAGLRPPKPPRP-ASLLRHAPHCLSEEEGEQDR 285
                    .:...:.|......:.....|.|.|.. ..::|..||.:.:.||...|
  Fly   219 --------IKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLR 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 57/108 (53%)
DnaJ 3..66 CDD:278647 39/63 (62%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 100/317 (32%)
DnaJ 4..65 CDD:278647 39/63 (62%)
DnaJ_C 174..338 CDD:199909 21/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117000040
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.